KEGG   Homo sapiens (human): 10921Help
Entry
10921             CDS       T01001                                 

Gene name
RNPS1, E5.1
Definition
(RefSeq) RNA binding protein with serine rich domain 1
  KO
K14325  
RNA-binding protein with serine-rich domain 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10921 (RNPS1)
   03015 mRNA surveillance pathway
    10921 (RNPS1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     10921 (RNPS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 305 aa AA seqDB search
MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD
KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSS
SGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEI
FSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLA
PWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSS
SNSSR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggatttatcaggagtgaaaaagaagagcttgctaggagtcaaagaaaataataaaaag
tccagcactagggctccttcacctaccaaacgcaaagaccgctcagatgagaagtccaag
gatcgctcaaaagataaaggggccaccaaggagtcgagtgagaaggatcgcggccgggac
aaaacccgaaagaggcgcagcgcttccagtggtagcagcagtaccaggtctcggtccagc
tcgacttccagctcaggctccagcaccagcactggctcaagcagtggctccagctcttcc
tcagcatccagccgctcaggaagctccagcacctcccgcagctccagctctagcagctct
tctggctctccaagtccttctcggcgcagacacgacaacaggaggcgctcccgctccaaa
tccaaaccacctaaaagagatgaaaaggagaggaaaaggcggagcccatctcctaagccc
accaaagtgcacattgggagactcacccggaatgtgacaaaggatcacatcatggagata
ttttccacctatgggaaaattaaaatgattgacatgcccgtggaaaggatgcatccccat
ctgtccaaaggctatgcgtacgtagagtttgagaatccagatgaagccgagaaggcgctg
aagcacatggatggaggacaaattgatggccaggagatcactgccaccgccgtgctggcc
ccctggcctaggccaccccccaggagattcagccctcccaggagaatgttgccaccaccg
cctatgtggcgcaggtctcccccacggatgaggagaaggtcccgctccccgaggcgcagg
tcccccgtgcgccggagatcacggtccccgggccgccgccgccacaggagccgctccagc
tccaactcctcccgataa

DBGET integrated database retrieval system