KEGG   Homo sapiens (human): 10928Help
Entry
10928             CDS       T01001                                 

Gene name
RALBP1, RIP1, RLIP1, RLIP76
Definition
ralA binding protein 1
Orthology
K08773  
RalA-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Pathways in cancer
Pancreatic cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.3
AA seq 655 aa AA seqDB search
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDV
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
IDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV
QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
ESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAK
AEQQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtgcttcctgccccccaccagcagccccagtgaacaccgcagggtggagcat
ggcagcgggcttacccggacccccagctctgaagagatcagccctactaagtttcctgga
ttgtaccgcactggcgagccctcacctccccatgacatcctccatgagcctcctgatgta
gtgtctgatgatgagaaagatcatgggaagaaaaaagggaaatttaagaaaaaggaaaag
aggactgaaggctatgcagcctttcaggaagatagctctggagatgaggcagaaagtcct
tctaaaatgaagaggtccaagggaatccatgttttcaagaagcccagcttttctaaaaag
aaggaaaaggattttaaaataaaagagaaacccaaagaagaaaagcataaagaagaaaag
cacaaagaagaaaaacataaagagaagaagtcaaaagacttgacagcagctgatgttgtt
aaacagtggaaggaaaagaagaaaaagaaaaagccaattcaggagccagaggtgcctcag
attgatgttccaaatctcaaacccatttttggaattcctttggctgatgcagtagagagg
accatgatgtatgatggcattcggctgccagccgttttccgtgaatgtatagattacgta
gagaagtatggcatgaagtgtgaaggcatctacagagtatcaggaattaaatcaaaggtg
gatgagctaaaagcagcctatgaccgggaggagtctacaaacttggaagactatgagcct
aacactgtagccagtttgctgaagcagtatttgcgagaccttccagagaatttgcttacc
aaagagcttatgcccagatttgaagaggcttgtgggaggaccacggagactgagaaagtg
caggaattccagcgtttactcaaagaactgccagaatgtaactatcttctgatttcttgg
ctcattgtgcacatggaccatgtcattgcaaaggaactggaaacaaaaatgaatatacag
aacatttctatagtgctcagcccaactgtgcagatcagcaatcgagtcctgtatgtgttt
ttcacacatgtgcaagaactctttggaaatgtggtactaaagcaagtgatgaaacctctg
cgatggtctaacatggccacgatgcccacgctgccagagacccaggcgggcatcaaggag
gagatcaggagacaggagtttcttttgaattgtttacatcgagatctgcagggtgggata
aaggatttgtctaaagaagaaagattatgggaagtacaaagaattttgacagccctcaaa
agaaaactgagagaagctaaaagacaggagtgtgaaaccaagattgcacaagagatagcc
agtctttcaaaagaggatgtttccaaagaagagatgaatgaaaatgaagaagttataaat
attctccttgctcaggagaatgagatcctgactgaacaggaggagctcctggccatggag
cagtttctgcgccggcagattgcctcagaaaaagaagagattgaacgcctcagagctgag
attgctgaaattcagagtcgccagcagcacggccgaagtgagactgaggagtactcctcc
gagagcgagagcgagagtgaggatgaggaggagctgcagatcattctggaagacttacag
agacagaacgaagagctggaaataaagaacaatcatttgaatcaagcaattcatgaggag
cgcgaggccatcatcgagctgcgcgtgcagctgcggctgctccagatgcagcgagccaag
gccgagcagcaggcgcaggaggacgaggagcctgagtggcgcgggggtgccgtccagccg
cccagagacggcgtccttgagccaaaagcagctaaagagcagccaaaggcaggcaaggag
ccggcaaagccatcgcccagcagggataggaaggagacgtccatctga

DBGET integrated database retrieval system