KEGG   Homo sapiens (human): 10928Help
Entry
10928             CDS       T01001                                 

Gene name
RALBP1, RIP1, RLIP1, RLIP76
Definition
ralA binding protein 1
Orthology
K08773  
RalA-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Pathways in cancer
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10928 (RALBP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10928 (RALBP1)
   05212 Pancreatic cancer
    10928 (RALBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.3
AA seq 655 aa AA seqDB search
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDV
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
IDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV
QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
ESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAK
AEQQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtgcttcctgccccccaccagcagccccagtgaacaccgcagggtggagcat
ggcagcgggcttacccggacccccagctctgaagagatcagccctactaagtttcctgga
ttgtaccgcactggcgagccctcacctccccatgacatcctccatgagcctcctgatgta
gtgtctgatgatgagaaagatcatgggaagaaaaaagggaaatttaagaaaaaggaaaag
aggactgaaggctatgcagcctttcaggaagatagctctggagatgaggcagaaagtcct
tctaaaatgaagaggtccaagggaatccatgttttcaagaagcccagcttttctaaaaag
aaggaaaaggattttaaaataaaagagaaacccaaagaagaaaagcataaagaagaaaag
cacaaagaagaaaaacataaagagaagaagtcaaaagacttgacagcagctgatgttgtt
aaacagtggaaggaaaagaagaaaaagaaaaagccaattcaggagccagaggtgcctcag
attgatgttccaaatctcaaacccatttttggaattcctttggctgatgcagtagagagg
accatgatgtatgatggcattcggctgccagccgttttccgtgaatgtatagattacgta
gagaagtatggcatgaagtgtgaaggcatctacagagtatcaggaattaaatcaaaggtg
gatgagctaaaagcagcctatgaccgggaggagtctacaaacttggaagactatgagcct
aacactgtagccagtttgctgaagcagtatttgcgagaccttccagagaatttgcttacc
aaagagcttatgcccagatttgaagaggcttgtgggaggaccacggagactgagaaagtg
caggaattccagcgtttactcaaagaactgccagaatgtaactatcttctgatttcttgg
ctcattgtgcacatggaccatgtcattgcaaaggaactggaaacaaaaatgaatatacag
aacatttctatagtgctcagcccaactgtgcagatcagcaatcgagtcctgtatgtgttt
ttcacacatgtgcaagaactctttggaaatgtggtactaaagcaagtgatgaaacctctg
cgatggtctaacatggccacgatgcccacgctgccagagacccaggcgggcatcaaggag
gagatcaggagacaggagtttcttttgaattgtttacatcgagatctgcagggtgggata
aaggatttgtctaaagaagaaagattatgggaagtacaaagaattttgacagccctcaaa
agaaaactgagagaagctaaaagacaggagtgtgaaaccaagattgcacaagagatagcc
agtctttcaaaagaggatgtttccaaagaagagatgaatgaaaatgaagaagttataaat
attctccttgctcaggagaatgagatcctgactgaacaggaggagctcctggccatggag
cagtttctgcgccggcagattgcctcagaaaaagaagagattgaacgcctcagagctgag
attgctgaaattcagagtcgccagcagcacggccgaagtgagactgaggagtactcctcc
gagagcgagagcgagagtgaggatgaggaggagctgcagatcattctggaagacttacag
agacagaacgaagagctggaaataaagaacaatcatttgaatcaagcaattcatgaggag
cgcgaggccatcatcgagctgcgcgtgcagctgcggctgctccagatgcagcgagccaag
gccgagcagcaggcgcaggaggacgaggagcctgagtggcgcgggggtgccgtccagccg
cccagagacggcgtccttgagccaaaagcagctaaagagcagccaaaggcaggcaaggag
ccggcaaagccatcgcccagcagggataggaaggagacgtccatctga

DBGET integrated database retrieval system