KEGG   Homo sapiens (human): 10929Help
Entry
10929             CDS       T01001                                 

Gene name
SRSF8, DSM-1, SFRS2B, SRP46
Definition
serine/arginine-rich splicing factor 8
Orthology
K12891  
splicing factor, arginine/serine-rich 2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10929 (SRSF8)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    10929 (SRSF8)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10929 (SRSF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22
AA seq 282 aa AA seqDB search
MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFV
RFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRS
YGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRY
RESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRS
RSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcggccgcccccctcccgacgtggacggcatgatcaccctcaaggtggacaac
ctgacctaccgcacctctcccgacagcttgaggcgcgtgttcgagaagtacgggcgcgtg
ggcgacgtgtacatcccgcgggagccccacaccaaggcgccccggggcttcgctttcgtc
cgctttcacgaccggcgcgacgcccaagacgccgaggccgccatggacggggcggagctg
gacggacgcgagctgcgggtgcaggtggcgcgctatggccgccgggacctgccccgcagc
cgccagggagagccacgcggcaggtccagaggcggcggctacggacggcggagccgcagc
tacgggcggcggagccgcagccccaggcggcgacaccgcagccgatcccggggtcccagc
tgctccaggtcccgcagccgatctcgctataggggttctcgctatagccggtctccctac
agccgatctccttacagccggtcgcgctacagccgctctccctacagcagatctcgctac
agggaatctcgctacggcggatctcactacagctcatctggttacagtaactctcgctac
agccgatatcacagcagccggtctcactcgaagtctgggtcctccactagctctcgctct
gcatcaacctccaaatcgagctctgcgcgacgatccaagtcctcctcggtctccaggtct
cgctcgcggtccaggtcttcatctatgaccaggagtcctccccgggtatccaagaggaaa
tccaagtcaaggtcgcgatccaagaggccccccaagtctcctgaagaggaaggacagatg
tcctcttaa

DBGET integrated database retrieval system