KEGG   Homo sapiens (human): 10935Help
Entry
10935             CDS       T01001                                 

Gene name
PRDX3, AOP-1, AOP1, HBC189, MER5, PRO1748, SP-22, prx-III
Definition
(RefSeq) peroxiredoxin 3 (EC:1.11.1.15)
  KO
K20011  
peroxiredoxin 3 [EC:1.11.1.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     10935 (PRDX3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10935 (PRDX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q25-q26
AA seq 256 aa AA seqDB search
MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSC
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
KPSPAASKEYFQKVNQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgctgtaggacggttgctccgagcgtcggttgcccgacatgtgagtgccatt
ccttggggcatttctgccactgcagccctcaggcctgctgcatgtggaagaacgagcttg
acaaatttattgtgttctggttccagtcaagcaaaattattcagcaccagttcctcatgc
catgcacctgctgtcacccagcatgcaccctattttaagggtacagccgttgtcaatgga
gagttcaaagacctaagccttgatgactttaaggggaaatatttggtgcttttcttctat
cctttggatttcacctttgtgtgtcctacagaaattgttgcttttagtgacaaagctaac
gaatttcacgacgtgaactgtgaagttgtcgcagtctcagtggattcccactttagccat
cttgcctggataaatacaccaagaaagaatggtggtttgggccacatgaacatcgcactc
ttgtcagacttaactaagcagatttcccgagactacggtgtgctgttagaaggttctggt
cttgcactaagaggtctcttcataattgaccccaatggagtcatcaagcatttgagcgtc
aacgatctcccagtgggccgaagcgtggaagaaaccctccgcttggtgaaggcgttccag
tatgtagaaacacatggagaagtctgcccagcgaactggacaccggattctcctacgatc
aagccaagtccagctgcttccaaagagtactttcagaaggtaaatcagtag

DBGET integrated database retrieval system