KEGG   Homo sapiens (human): 10941Help
Entry
10941             CDS       T01001                                 

Gene name
UGT2A1, UDPGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    10941 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    10941 (UGT2A1)
   00500 Starch and sucrose metabolism
    10941 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    10941 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10941 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    10941 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    10941 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    10941 (UGT2A1)
   00983 Drug metabolism - other enzymes
    10941 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    10941 (UGT2A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     10941 (UGT2A1)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   10941 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13
AA seq 693 aa AA seqDB search
MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALDG
SHWLNIKIILEELIQRNHNVTVLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHM
IMLWIDHRPTPLTIWAFYKELGKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVAD
PVTICGDLVALKLGIPFMYTLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERI
KNTISYSLQDYIFQSYWGEWNSYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLP
NFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGG
TNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEP
SYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGF
LLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaaccttctgctgttctcccttcagataagtctcataggaaccactcttggt
gggaatgttttgatttggccaatggaaggtagtcattggctaaatgttaagataattata
gatgagctcattaaaaaggagcataatgtgactgtcctagttgcctctggtgcacttttc
atcacaccaacctctaacccatctctgacatttgaaatatataaggtgccctttggcaaa
gaaagaatagaaggagtaattaaggacttcgttttgacatggctggaaaatagaccatct
ccttcaaccatttggagattctatcaggagatggccaaagtaatcaaggacttccacatg
gtgtctcaggagatctgtgatggcgttcttaaaaaccaacagctgatggcaaagctaaag
aaaagcaagtttgaagtcctggtgtctgatccagtatttccttgtggcgatatagtagct
ttaaaacttggaattccatttatgtactccttgaggttttctccagcctcaacagtggaa
aagcactgtgggaaggtaccataccctccttcctatgttcctgctgttttatcagaactc
accgaccaaatgtctttcactgacagaataagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaatcatgggattcatactatagtaaagctttagatggt
agccattggttaaatattaagattattctagaagagttgattcaaagaaatcacaatgtg
actgtactggcttcatcagcaactctattcatcaactccaatcccgattctcctgtgaat
tttgaagtgatacctgtttcctacaagaagagcaatatagattccttaattgagcatatg
ataatgctgtggattgaccatagaccaactcctctcacaatatgggctttctacaaagaa
ctaggaaaacttctagacactttctttcaaattaacatacaactctgtgatggtgtacta
aagaacccaaagttgatggcaagacttcagaaaggtggttttgatgtgttggtagcagac
ccagtaacaatctgtggtgatcttgttgctctgaaattaggaattccatttatgtacaca
ttgaggttctctccagcatcaacagtggagagacactgtgggaaaatcccagcaccagtc
tcctatgtaccggcagccttatcagagctcactgaccagatgacctttggtgaaaggatt
aaaaataccatatcttattctctgcaagactatatatttcagtcctactggggagaatgg
aattcatactatagcaaaattttaggaagacccactacgttatgtgagactatggggaaa
gctgaaatttggttaatccgaacatattgggattttgaatttcctcgtccatacttacct
aattttgagtttgttggaggattgcactgcaaacctgccaaacctttacctaaggtttta
tggagatacaaaggaaagaaaccagccacattaggaaacaatactcagctctttgattgg
ataccccagaatgatcttcttggacatcccaaaaccaaagcttttatcactcatggtgga
actaatgggatctacgaagctatttaccacggagtccctatggtgggagttcccatgttt
gctgatcagcctgataacattgctcacatgaaggccaaaggagcagctgtggaagtgaac
ctaaacacaatgacaagtgtggatttgcttagcgctttgagaacagtcattaatgaacct
tcttataaagagaatgctatgaggttatcaagaattcaccatgatcaacctgtaaagccc
ctggatcgagcagtcttctggatcgagtttgtcatgcgccacaaaggagccaagcacctt
cgggttgcagcccatgacctcacctggttccagtaccactctttggatgtaattgggttc
ttgctggtctgtgtgacaacggctatatttttggtcatacaatgttgtttgttttcctgt
caaaaatttggtaagataggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system