KEGG   Homo sapiens (human): 10947Help
Entry
10947             CDS       T01001                                 

Gene name
AP3M2, AP47B, CLA20, P47B
Definition
(RefSeq) adaptor related protein complex 3 mu 2 subunit
  KO
K12398  AP-3 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    10947 (AP3M2)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    10947 (AP3M2)
 Endosome - Golgi transport
    10947 (AP3M2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Motif
Other DBs
NCBI-GeneID: 10947
NCBI-ProteinID: NP_001127768
OMIM: 610469
HGNC: 570
Ensembl: ENSG00000070718
Vega: OTTHUMG00000164060
Pharos: P53677(Tdark)
UniProt: P53677
Position
8p11.21
AA seq 418 aa AA seqDB search
MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVY
RHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNG
FPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAY
FDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFK
RWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQT
MGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSL
QAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatccatagtcttttcttgatcaactcctctggagacattttcctggagaaacattgg
aaaagtgtggtcagccgttctgtttgtgattacttttttgaggcgcaagagagagctact
gaggcagaaaatgtgcctccggttatccctacccctcaccactatctcttaagtgtttac
cgccacaagatcttttttgtggccgtgatccagacggaggtcccccctctgtttgtcatt
gagtttcttcaccgagtggtggacacatttcaggattattttggagtctgttcagagcca
gtgatcaaagacaatgtagttgtggtttatgaggtattggaagagatgcttgacaatggt
tttccattggctaccgagtcgaacattcttaaagaactcataaagcctcctaccatcctt
cgaacggttgtcaacaccatcacaggaagcacgaatgtgggtgaccagcttcccactggg
cagctgtcagtggtgccttggcgacggactggggtgaaatataccaacaatgaggcctat
tttgatgtgattgaagagattgatgcaattattgataaatcaggctccacaattactgct
gagatccagggggtgattgatgcctgtgtcaagctgactggcatgccagaccttacactt
tccttcatgaaccctaggttgttggatgatgtcagcttccatccttgtgttcgtttcaaa
cgctgggaatctgagcgcatcctctccttcatccctcctgatggaaacttccgcctgctg
tcttaccatgtcagtgcacagaatctggttgcaatcccagtgtatgtcaaacataacatc
agtttccgggacagtagttcccttggacgctttgaaataacggtgggacccaagcagacg
atggggaagaccattgagggagtgactgtcaccagccagatgcccaagggggtcctgaac
atgagccttactccatcacaggggacacacacattcgacccagtcacaaagatgctgtct
tgggatgtaggaaaaataaatccacaaaagctaccaagtttgaaggggaccatgagtctt
caggctggagcttccaaaccagatgaaaaccccacaattaacctgcagtttaagatccag
cagctggccatttctggactcaaggtgaatcgtctggatatgtatggagaaaagtacaaa
ccctttaagggcataaaatacatgaccaaagctgggaagttccaagttcgaacctga

DBGET integrated database retrieval system