KEGG   Homo sapiens (human): 10947Help
Entry
10947             CDS       T01001                                 

Gene name
AP3M2, AP47B, CLA20, P47B
Definition
adaptor-related protein complex 3, mu 2 subunit
Orthology
K12398  
AP-3 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.2
AA seq 418 aa AA seqDB search
MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVY
RHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNG
FPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAY
FDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFK
RWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQT
MGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSL
QAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatccatagtcttttcttgatcaactcctctggagacattttcctggagaaacattgg
aaaagtgtggtcagccgttctgtttgtgattacttttttgaggcgcaagagagagctact
gaggcagaaaatgtgcctccggttatccctacccctcaccactatctcttaagtgtttac
cgccacaagatcttttttgtggccgtgatccagacggaggtcccccctctgtttgtcatt
gagtttcttcaccgagtggtggacacatttcaggattattttggagtctgttcagagcca
gtgatcaaagacaatgtagttgtggtttatgaggtattggaagagatgcttgacaatggt
tttccattggctaccgagtcgaacattcttaaagaactcataaagcctcctaccatcctt
cgaacggttgtcaacaccatcacaggaagcacgaatgtgggtgaccagcttcccactggg
cagctgtcagtggtgccttggcgacggactggggtgaaatataccaacaatgaggcctat
tttgatgtgattgaagagattgatgcaattattgataaatcaggctccacaattactgct
gagatccagggggtgattgatgcctgtgtcaagctgactggcatgccagaccttacactt
tccttcatgaaccctaggttgttggatgatgtcagcttccatccttgtgttcgtttcaaa
cgctgggaatctgagcgcatcctctccttcatccctcctgatggaaacttccgcctgctg
tcttaccatgtcagtgcacagaatctggttgcaatcccagtgtatgtcaaacataacatc
agtttccgggacagtagttcccttggacgctttgaaataacggtgggacccaagcagacg
atggggaagaccattgagggagtgactgtcaccagccagatgcccaagggggtcctgaac
atgagccttactccatcacaggggacacacacattcgacccagtcacaaagatgctgtct
tgggatgtaggaaaaataaatccacaaaagctaccaagtttgaaggggaccatgagtctt
caggctggagcttccaaaccagatgaaaaccccacaattaacctgcagtttaagatccag
cagctggccatttctggactcaaggtgaatcgtctggatatgtatggagaaaagtacaaa
ccctttaagggcataaaatacatgaccaaagctgggaagttccaagttcgaacctga

DBGET integrated database retrieval system