KEGG   Homo sapiens (human): 10950Help
Entry
10950             CDS       T01001                                 

Gene name
BTG3, ANA, ANA/BTG3, APRO4, TOB5, TOB55, TOFA
Definition
(RefSeq) BTG anti-proliferation factor 3
  KO
K14443  protein Tob/BTG
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    10950 (BTG3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     10950 (BTG3)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     10950 (BTG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTG
Motif
Other DBs
NCBI-GeneID: 10950
NCBI-ProteinID: NP_006797
OMIM: 605674
HGNC: 1132
Ensembl: ENSG00000154640
Vega: OTTHUMG00000074501
Pharos: Q14201(Tbio)
UniProt: Q14201 Q6IAU3
Position
21q21.1
AA seq 252 aa AA seqDB search
MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCI
RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENK
DENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFP
PLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDR
NHWINPHMLAPH
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgaaattgctgccgttgtcttctttttcacaaggctagttcgaaaacatgat
aagttgaaaaaagaggcagttgagaggtttgctgagaaattgaccctaatacttcaagaa
aaatataaaaatcactggtatccagaaaaaccatcgaaaggacaggcctacagatgtatt
cgtgtcaataaatttcagagagttgatcctgatgtcctgaaagcctgtgaaaacagctgc
atcttgtatagtgacctgggcttgccaaaggagctcactctctgggtggacccatgtgag
gtgtgctgtcggtatggagagaaaaacaatgcattcattgttgccagctttgaaaataaa
gatgagaacaaggatgagatctccaggaaagttaccagggcccttgataaggttacctct
gattatcattcaggatcctcttcttcagatgaagaaacaagtaaggaaatggaagtgaaa
cccagttcggtgactgcagccgcaagtcctgtgtaccagatttcagaacttatatttcca
cctcttccaatgtggcaccctttgcccagaaaaaagccaggaatgtatcgagggaatggc
catcagaatcactatcctcctcctgttccatttggttatccaaatcagggaagaaaaaat
aaaccatatcgcccaattccagtgacatgggtacctcctcctggaatgcattgtgaccgg
aatcactggattaatcctcacatgttagcacctcactaa

DBGET integrated database retrieval system