KEGG   Homo sapiens (human): 10952Help
Entry
10952             CDS       T01001                                 

Gene name
SEC61B
Definition
Sec61 beta subunit
Orthology
K09481  
protein transport protein SEC61 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Protein processing in endoplasmic reticulum
Phagosome
Vibrio cholerae infection
Module
Sec61 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q22.32-q31.3
AA seq 96 aa AA seqDB search
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtccgacccccagtggcactaacgtgggatcctcagggcgctctcccagcaaa
gcagtggccgcccgggcggcgggatccactgtccggcagaggaaaaatgccagctgtggg
acaaggagtgcaggccgcacaacctcggcaggcaccggggggatgtggcgattctacaca
gaagattcacctgggctcaaagttggccctgttccagtattggttatgagtcttctgttc
atcgcttctgtatttatgttgcacatttggggcaagtacactcgttcgtag

DBGET integrated database retrieval system