KEGG   Homo sapiens (human): 10952Help
Entry
10952             CDS       T01001                                 

Gene name
SEC61B
Definition
Sec61 beta subunit
Orthology
K09481  
protein transport protein SEC61 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Protein processing in endoplasmic reticulum
Phagosome
Vibrio cholerae infection
Module
Sec61 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    10952 (SEC61B)
   04141 Protein processing in endoplasmic reticulum
    10952 (SEC61B)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10952 (SEC61B)
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    10952 (SEC61B)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   10952 (SEC61B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q22.32-q31.3
AA seq 96 aa AA seqDB search
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtccgacccccagtggcactaacgtgggatcctcagggcgctctcccagcaaa
gcagtggccgcccgggcggcgggatccactgtccggcagaggaaaaatgccagctgtggg
acaaggagtgcaggccgcacaacctcggcaggcaccggggggatgtggcgattctacaca
gaagattcacctgggctcaaagttggccctgttccagtattggttatgagtcttctgttc
atcgcttctgtatttatgttgcacatttggggcaagtacactcgttcgtag

DBGET integrated database retrieval system