KEGG   Homo sapiens (human): 10954Help
Entry
10954             CDS       T01001                                 

Gene name
PDIA5, PDIR
Definition
protein disulfide isomerase family A, member 5 (EC:5.3.4.1)
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     10954 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21.1
AA seq 519 aa AA seqDB search
MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAA
ENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFAEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggccgggccggcgtggctgctgctggcaatctgggtggtcctgccatcatgg
ctgtcctctgcaaaggtctcctcgctcattgagagaatctctgaccccaaggacttgaaa
aaactgctcagaacccggaataatgtactggtgctttactccaaatctgaggtggcagct
gaaaatcatctcaggttactgtccacagtggcccaggcggtgaaaggacaagggaccatc
tgctgggtggactgtggtgatgcagagagtagaaaattgtgcaagaagatgaaagttgac
ctgagcccgaaggacaaaaaggttgaattattccattaccaggatggtgcatttcatact
gaatataaccgagctgtgacatttaagtccatagtggcctttttgaaggatccaaaaggg
cccccactgtgggaggaagatcctggagccaaagatgttgtccaccttgacagtgaaaag
gacttcagacggctcctgaagaaggaagagaagccgctcctgatcatgttttatgccccc
tggtgcagcatgtgcaagaggatgatgccgcatttccagaaggctgcgactcagctgcga
ggccacgccgtgctggccgggatgaatgtctactcctctgaatttgaaaacatcaaggag
gagtacagcgtgcgcggcttccccaccatctgctattttgagaaaggacggttcttgttc
cagtatgacaactatgggtccacagctgaggacattgtggagtggctgaagaatccgcag
ccgccacagccccaggtccctgagactccctgggcagatgagggcggctccgtttatcac
ctgaccgatgaagactttgaccagtttgtgaaggaacactcctctgtcctcgtcatgttc
cacgccccatggtgtggccactgtaagaaaatgaagccggagtttgagaaggcagcagaa
gccctccatggagaagcggatagctctggtgtccttgcagctgtcgatgccactgtcaac
aaggccctggcagaaagattccacatctcagagtttcctacgttgaagtattttaagaat
ggagagaaatacgcagtgcctgtgctcaggacaaagaagaagtttctcgagtggatgcaa
aaccctgaggcccccccgcccccagagcccacgtgggaagagcagcagacaagcgtgttg
cacctggtgggggacaacttccgggagaccctgaagaagaagaaacacaccttggtcatg
ttctacgccccttggtgcccacactgtaagaaggtcattccgcactttactgctactgct
gatgccttcaaagatgaccgaaagattgcctgtgccgctgttgactgtgtcaaagacaag
aaccaagacctgtgccagcaggaggcggtcaagggctaccccactttccactactaccac
tatgggaagttcgcagaaaagtatgacagcgaccgcacagaattgggatttaccaattat
attcgagccctccgggagggagaccatgaaagactagggaaaaagaaggaagagttataa

DBGET integrated database retrieval system