KEGG   Homo sapiens (human): 10956Help
Entry
10956             CDS       T01001                                 

Gene name
OS9, ERLEC2, OS-9
Definition
osteosarcoma amplified 9, endoplasmic reticulum lectin
Orthology
K10088  
protein OS-9
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
HRD1/SEL1 ERAD complex
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 612 aa AA seqDB search
MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDV
VIVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTY
EFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSK
CDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAA
PQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGAS
PTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIR
SPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDED
EDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSEVKAGMERELENIIQETEKELDPDGL
KKESERDRAMLALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTGKIEIKI
VRPWAEGTEEGARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPG
GEGTGDLDEFDF
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaacgctgctgtccagtttgttaggactgctgcttctgggactcctgtta
cccgcaagtctgaccggcggtgtcgggagcctgaacctggaggagctgagtgagatgcgt
tatgggatcgagatcctgccgttgcctgtcatgggagggcagagccaatcttcggacgtg
gtgattgtctcctctaagtacaaacagcgctatgagtgtcgcctgccagctggagctatt
cacttccagcgtgaaagggaggaggaaacacctgcttaccaagggcctgggatccctgag
ttgttgagcccaatgagagatgctccctgcttgctgaagacaaaggactggtggacatat
gaattctgttatggacgccacatccagcaataccacatggaagattcagagatcaaaggt
gaagtcctctatctcggctactaccaatcagccttcgactgggatgatgaaacagccaag
gcctccaagcagcatcgtcttaaacgctaccacagccagacctatggcaatgggtccaag
tgcgaccttaatgggaggccccgggaggccgaggttcggttcctctgtgacgagggtgca
ggtatctctggggactacatcgatcgcgtggacgagcccttgtcctgctcttatgtgctg
accattcgcactcctcggctctgcccccaccctctcctccggcccccacccagtgctgca
ccgcaggccatcctctgtcacccttccctacagcctgaggagtacatggcctacgttcag
aggcaagccgactcaaagcagtatggagataaaatcatagaggagctgcaagatctaggc
ccccaagtgtggagtgagaccaagtctggggtggcaccccaaaagatggcaggtgcgagc
ccgaccaaggatgacagtaaggactcagatttctggaagatgcttaatgagccagaggac
caggccccaggaggggaggaggtgccggctgaggagcaggacccaagccctgaggcagca
gattcagcttctggtgctcccaatgattttcagaacaacgtgcaggtcaaagtcattcga
agccctgcggatttgattcgattcatagaggagctgaaaggtggaacaaaaaaggggaag
ccaaatataggccaagagcagcctgtggatgatgctgcagaagtccctcagagggaacca
gagaaggaaaggggtgatccagaacggcagagagagatggaagaagaggaggatgaggat
gaggatgaggatgaagatgaggatgaacggcagttactgggagaatttgagaaggaactg
gaagggatcctgcttccgtcagaccgagaccggctccgttcggaggtgaaggctggcatg
gagcgggaactggaaaacatcatccaggagacagagaaagagctggacccagatgggctg
aagaaggagtcagagcgggatcgggcaatgctggctctcacatccactctcaacaaactc
atcaaaagactggaggaaaaacagagtccagagctggtgaagaagcacaagaaaaagagg
gttgtccccaaaaagcctcccccatcaccccaacctacagggaaaattgagatcaaaatt
gtccgcccatgggctgaagggactgaagagggtgcacgttggctgactgatgaggacacg
agaaacctcaaggagatcttcttcaatatcttggtgccgggagctgaagaggcccagaag
gaacgccagcggcagaaagagctggagagcaattaccgccgggtgtggggctctccaggt
ggggagggcacaggggacctggacgaatttgacttctga

DBGET integrated database retrieval system