KEGG   Homo sapiens (human): 10956Help
Entry
10956             CDS       T01001                                 

Gene name
OS9, ERLEC2, OS-9
Definition
(RefSeq) OS9, endoplasmic reticulum lectin
  KO
K10088  protein OS-9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00403  HRD1/SEL1 ERAD complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10956 (OS9)
Lectins [BR:hsa04091]
 P-type lectins
  10956 (OS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRKCSH PRKCSH_1 ATG27
Motif
Other DBs
NCBI-GeneID: 10956
NCBI-ProteinID: NP_006803
OMIM: 609677
HGNC: 16994
Ensembl: ENSG00000135506
Vega: OTTHUMG00000170284
Pharos: Q13438(Tbio)
UniProt: Q13438
Structure
PDB: 

Jmol
Position
12q13.3-q14.1
AA seq 667 aa AA seqDB search
MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDV
VIVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTY
EFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSK
CDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAA
PQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGAS
PTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIR
SPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDED
EDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSEVKAGMERELENIIQETEKELDPDGL
KKESERDRAMLALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTEEDPEHR
VRVRVTKLRLGGPNQDLTVLEMKRENPQLKQIEGLVKELLEREGLTAAGKIEIKIVRPWA
EGTEEGARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTG
DLDEFDF
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaacgctgctgtccagtttgttaggactgctgcttctgggactcctgtta
cccgcaagtctgaccggcggtgtcgggagcctgaacctggaggagctgagtgagatgcgt
tatgggatcgagatcctgccgttgcctgtcatgggagggcagagccaatcttcggacgtg
gtgattgtctcctctaagtacaaacagcgctatgagtgtcgcctgccagctggagctatt
cacttccagcgtgaaagggaggaggaaacacctgcttaccaagggcctgggatccctgag
ttgttgagcccaatgagagatgctccctgcttgctgaagacaaaggactggtggacatat
gaattctgttatggacgccacatccagcaataccacatggaagattcagagatcaaaggt
gaagtcctctatctcggctactaccaatcagccttcgactgggatgatgaaacagccaag
gcctccaagcagcatcgtcttaaacgctaccacagccagacctatggcaatgggtccaag
tgcgaccttaatgggaggccccgggaggccgaggttcggttcctctgtgacgagggtgca
ggtatctctggggactacatcgatcgcgtggacgagcccttgtcctgctcttatgtgctg
accattcgcactcctcggctctgcccccaccctctcctccggcccccacccagtgctgca
ccgcaggccatcctctgtcacccttccctacagcctgaggagtacatggcctacgttcag
aggcaagccgactcaaagcagtatggagataaaatcatagaggagctgcaagatctaggc
ccccaagtgtggagtgagaccaagtctggggtggcaccccaaaagatggcaggtgcgagc
ccgaccaaggatgacagtaaggactcagatttctggaagatgcttaatgagccagaggac
caggccccaggaggggaggaggtgccggctgaggagcaggacccaagccctgaggcagca
gattcagcttctggtgctcccaatgattttcagaacaacgtgcaggtcaaagtcattcga
agccctgcggatttgattcgattcatagaggagctgaaaggtggaacaaaaaaggggaag
ccaaatataggccaagagcagcctgtggatgatgctgcagaagtccctcagagggaacca
gagaaggaaaggggtgatccagaacggcagagagagatggaagaagaggaggatgaggat
gaggatgaggatgaagatgaggatgaacggcagttactgggagaatttgagaaggaactg
gaagggatcctgcttccgtcagaccgagaccggctccgttcggaggtgaaggctggcatg
gagcgggaactggaaaacatcatccaggagacagagaaagagctggacccagatgggctg
aagaaggagtcagagcgggatcgggcaatgctggctctcacatccactctcaacaaactc
atcaaaagactggaggaaaaacagagtccagagctggtgaagaagcacaagaaaaagagg
gttgtccccaaaaagcctcccccatcaccccaacctacagaggaggatcctgagcacaga
gtccgggtccgggtcaccaagctccgtctcggaggccctaatcaggatctgactgtcctc
gagatgaaacgggaaaacccacagctgaaacaaatcgaggggctggtgaaggagctgctg
gagagggagggactcacagctgcagggaaaattgagatcaaaattgtccgcccatgggct
gaagggactgaagagggtgcacgttggctgactgatgaggacacgagaaacctcaaggag
atcttcttcaatatcttggtgccgggagctgaagaggcccagaaggaacgccagcggcag
aaagagctggagagcaattaccgccgggtgtggggctctccaggtggggagggcacaggg
gacctggacgaatttgacttctga

DBGET integrated database retrieval system