KEGG   Homo sapiens (human): 10970Help
Entry
10970             CDS       T01001                                 

Gene name
CKAP4, CLIMP-63, ERGIC-63, p63
Definition
cytoskeleton-associated protein 4
Orthology
K13999  
cytoskeleton-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10970 (CKAP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q23.3
AA seq 602 aa AA seqDB search
MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQ
NQAHGKGGHRGGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAA
AFSGWCVHHVLEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQ
HKQDLTEKAVKQGESEVSRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEER
LTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSA
KSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSE
ESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQL
VLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLK
ASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHE
KV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccctcggccaaacaaaggggctccaagggcggccacggcgccgcgagcccctcggag
aagggtgcccacccgtcgggcggcgcggatgacgtggcgaagaagccgccgccggcgccg
cagcagccgccgccgccgcccgcgccgcacccgcagcagcacccgcagcagcacccgcag
aaccaggcgcacggcaagggcggccaccgcggcggcggcggcggcggcggcaagtcctcc
tcctcctcctccgcctccgccgccgctgccgccgccgccgcctcgtcctcggcgtcctgc
tcgcgcaggctcggcagggcgctcaactttctcttctacctcgccctggtggcggcggcc
gctttctcgggctggtgcgtccaccacgtcctggaggaggtccagcaggtccggcgcagc
caccaggacttctcccggcagagggaggagctgggccagggcttgcagggcgtcgagcag
aaggtgcagtctttgcaagccacatttggaacttttgagtccatcttgagaagctcccaa
cataaacaagacctcacagagaaagctgtgaagcaaggggagagtgaggtcagccggatc
agcgaagtgctgcagaaactccagaatgagattctcaaagacctctcggatgggatccat
gtggtgaaggacgcccgggagcgggacttcacgtccctggagaacacggtggaggagcgg
ctgacggagctcaccaaatccatcaacgacaacatcgccatcttcacagaagtccagaag
aggagccagaaggagatcaatgacatgaaggcaaaggttgcctccctggaagaatctgag
gggaacaagcaggatttgaaagccttaaaggaagctgtgaaggagatacagacctcagcc
aagtccagagagtgggacatggaggccctgagaagtacccttcagactatggagtctgac
atctacaccgaggtccgcgagctggtgagcctcaagcaggagcagcaggctttcaaggag
gcggccgacacggagcggctcgccctgcaggccctcacggagaagcttctcaggtctgag
gagtccgtctcccgcctcccggaggagatccggagactggaggaagagctccgccagctg
aagtccgattcccacgggccgaaggaggacggaggcttcagacactcggaagcctttgag
gcactccagcaaaagagtcagggactggactccaggctccagcacgtggaggatggggtg
ctctccatgcaggtggcttctgcgcgccagaccgagagcctggagtccctcctgtccaag
agccaggagcacgagcagcgcctggccgccctgcaggggcgcctggaaggcctcgggtcc
tcagaggcagaccaggatggcctggccagcacggtgaggagcctgggcgagacccagctg
gtgctctacggtgacgtggaggagctgaagaggagtgtgggcgagctccccagcaccgtg
gaatcactccagaaggtgcaggagcaggtgcacacgctgctcagtcaggaccaagcccag
gccgcccgtctgcctcctcaggacttcctggacagactttcttctctagacaacctgaaa
gcctcagtcagccaagtggaggcggacttgaaaatgctcaggactgctgtggacagtttg
gttgcatactcggtcaaaatagaaaccaacgagaacaatctggaatcagccaagggttta
ctagatgacctgaggaatgatctggataggttgtttgtgaaagtggagaagattcacgaa
aaggtctaa

DBGET integrated database retrieval system