KEGG   Homo sapiens (human): 10975Help
Entry
10975             CDS       T01001                                 

Gene name
UQCR11, 0710008D09Rik, QCR10, UQCR
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit XI
  KO
K00420  
ubiquinol-cytochrome c reductase subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    10975 (UQCR11)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    10975 (UQCR11)
  Environmental adaptation
   04714 Thermogenesis
    10975 (UQCR11)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    10975 (UQCR11)
   05012 Parkinson's disease
    10975 (UQCR11)
   05016 Huntington's disease
    10975 (UQCR11)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    10975 (UQCR11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14957(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 56 aa AA seqDB search
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggtgacccggttcctgggcccacgctaccgggagctggtcaagaactgggtcccgacg
gcctacacatggggcgctgtgggcgccgtggggctggtgtgggccaccgattggcggctg
atcctggactgggtaccttacatcaatggcaagtttaagaaggataattaa

KEGG   Homo sapiens (human): 1537Help
Entry
1537              CDS       T01001                                 

Gene name
CYC1, MC3DN6, UQCR4
Definition
(RefSeq) cytochrome c1
  KO
K00413  
ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex respiratory unit
Cytochrome bc1 complex
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1537 (CYC1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1537 (CYC1)
  Environmental adaptation
   04714 Thermogenesis
    1537 (CYC1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1537 (CYC1)
   05012 Parkinson's disease
    1537 (CYC1)
   05016 Huntington's disease
    1537 (CYC1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1537 (CYC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P08574(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 325 aa AA seqDB search
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctgcggcttcgcttcgcggggtagtgttgggcccgcggggcgcggggctc
ccgggcgcgcgtgcccggggtctgctgtgcagcgcgcgtcccgggcagctcccgctacgg
acacctcaggcagtggccttgtcgtcgaagtctggcctttcccgaggccggaaagtgatg
ctgtcagcgctgggcatgctggcggcagggggtgcggggctggccgtggctctgcattcg
gctgtgagtgccagtgacctggagctgcacccccccagctatccgtggtctcaccgtggc
ctcctctcttccttggaccacaccagcatccggaggggtttccaggtatataagcaggtg
tgcgcctcctgccacagcatggacttcgtggcctaccgccacctggtgggcgtgtgctac
acggaggatgaagctaaggagctggctgcggaggtggaggttcaagacggccccaatgaa
gatggggagatgttcatgcggccagggaagctgttcgactatttcccaaaaccatacccc
aacagtgaggctgctcgagctgccaacaacggagcattgccccctgacctcagctacatc
gtgcgagctaggcatggtggtgaggactacgtcttctccctgctcacgggctactgcgag
ccacccaccggggtgtcactgcgggaaggtctctacttcaacccctactttcctggccag
gccattgccatggcccctcccatctacacagatgtcttagagtttgacgatggcacccca
gctaccatgtcccagatagccaaggatgtgtgcaccttcctgcgctgggcatctgagcca
gagcacgaccatcgaaaacgcatggggctcaagatgttgatgatgatggctctgctggtg
cccctggtctacaccataaagcggcacaagtggtcagtcctgaagagtcggaagctggca
tatcggccgcccaagtga

KEGG   Homo sapiens (human): 27089Help
Entry
27089             CDS       T01001                                 

Gene name
UQCRQ, MC3DN4, QCR8, QP-C, QPC, UQCR7
Definition
(RefSeq) ubiquinol-cytochrome c reductase complex III subunit VII
  KO
K00418  
ubiquinol-cytochrome c reductase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    27089 (UQCRQ)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    27089 (UQCRQ)
  Environmental adaptation
   04714 Thermogenesis
    27089 (UQCRQ)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    27089 (UQCRQ)
   05012 Parkinson's disease
    27089 (UQCRQ)
   05016 Huntington's disease
    27089 (UQCRQ)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    27089 (UQCRQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14949(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 82 aa AA seqDB search
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcgagtttgggaatctgacgcggatgcggcatgtgatcagctacagcttgtca
ccgttcgagcagcgcgcctatccgcacgtcttcactaaaggaatccccaatgttctgcgc
cgcattcgggagtctttctttcgcgtggtgccgcagtttgtagtgttttatcttatctac
acatgggggactgaagagttcgagagatccaagaggaagaatccagctgcctatgaaaat
gacaaatga

KEGG   Homo sapiens (human): 29796Help
Entry
29796             CDS       T01001                                 

Gene name
UQCR10, HSPC051, HSPC119, HSPC151, QCR9, UCCR7.2, UCRC
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit X
  KO
K00419  
ubiquinol-cytochrome c reductase subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    29796 (UQCR10)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    29796 (UQCR10)
  Environmental adaptation
   04714 Thermogenesis
    29796 (UQCR10)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29796 (UQCR10)
   05012 Parkinson's disease
    29796 (UQCR10)
   05016 Huntington's disease
    29796 (UQCR10)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29796 (UQCR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UDW1(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 63 aa AA seqDB search
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
ENK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgacgttgacttcgaaattgtactccctgctgttccgcaggacctccacc
ttcgccctcaccatcatcgtgggcgtcatgttcttcgagcgcgccttcgatcaaggcgcg
gacgctatctacgaccacatcaacgaggggaagctgtggaaacacatcaagcacaagtat
gagaacaagtag

KEGG   Homo sapiens (human): 440567Help
Entry
440567            CDS       T01001                                 

Gene name
UQCRHL
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein like
  KO
K00416  
ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    440567 (UQCRHL)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    440567 (UQCRHL)
  Environmental adaptation
   04714 Thermogenesis
    440567 (UQCRHL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    440567 (UQCRHL)
   05012 Parkinson's disease
    440567 (UQCRHL)
   05016 Huntington's disease
    440567 (UQCRHL)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    440567 (UQCRHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.21
AA seq 91 aa AA seqDB search
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSR
SHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctatgatgagcatgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcaaaggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

KEGG   Homo sapiens (human): 4519Help
Entry
4519              CDS       T01001                                 

Gene name
CYTB, MTCYB, MT-CYB
Definition
(RefSeq) cytochrome b
  KO
K00412  
ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex respiratory unit
Cytochrome bc1 complex
Disease
H00068  
Leber hereditary optic atrophy (LHON)
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01355  
Kearns-Sayre syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4519 (CYTB)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4519 (CYTB)
  Environmental adaptation
   04714 Thermogenesis
    4519 (CYTB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4519 (CYTB)
   05012 Parkinson's disease
    4519 (CYTB)
   05016 Huntington's disease
    4519 (CYTB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4519 (CYTB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    4519 (CYTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Pharos: 
P00156(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
MT
AA seq 380 aa AA seqDB search
MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA
NT seq 1141 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaatacgcaaaactaaccccctaataaaattaattaaccactcattcatcgac
ctccccaccccatccaacatctccgcatgatgaaacttcggctcactccttggcgcctgc
ctgatcctccaaatcaccacaggactattcctagccatgcactactcaccagacgcctca
accgccttttcatcaatcgcccacatcactcgagacgtaaattatggctgaatcatccgc
taccttcacgccaatggcgcctcaatattctttatctgcctcttcctacacatcgggcga
ggcctatattacggatcatttctctactcagaaacctgaaacatcggcattatcctcctg
cttgcaactatagcaacagccttcataggctatgtcctcccgtgaggccaaatatcattc
tgaggggccacagtaattacaaacttactatccgccatcccatacattgggacagaccta
gttcaatgaatctgaggaggctactcagtagacagtcccaccctcacacgattctttacc
tttcacttcatcttgcccttcattattgcagccctagcaacactccacctcctattcttg
cacgaaacgggatcaaacaaccccctaggaatcacctcccattccgataaaatcaccttc
cacccttactacacaatcaaagacgccctcggcttacttctcttccttctctccttaatg
acattaacactattctcaccagacctcctaggcgacccagacaattataccctagccaac
cccttaaacacccctccccacatcaagcccgaatgatatttcctattcgcctacacaatt
ctccgatccgtccctaacaaactaggaggcgtccttgccctattactatccatcctcatc
ctagcaataatccccatcctccatatatccaaacaacaaagcataatatttcgcccacta
agccaatcactttattgactcctagccgcagacctcctcattctaacctgaatcggagga
caaccagtaagctacccttttaccatcattggacaagtagcatccgtactatacttcaca
acaatcctaatcctaataccaactatctccctaattgaaaacaaaatactcaaatgggcc
t

KEGG   Homo sapiens (human): 7381Help
Entry
7381              CDS       T01001                                 

Gene name
UQCRB, MC3DN3, QCR7, QP-C, QPC, UQBC, UQBP, UQCR6, UQPC
Definition
(RefSeq) ubiquinol-cytochrome c reductase binding protein
  KO
K00417  
ubiquinol-cytochrome c reductase subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    7381 (UQCRB)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7381 (UQCRB)
  Environmental adaptation
   04714 Thermogenesis
    7381 (UQCRB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7381 (UQCRB)
   05012 Parkinson's disease
    7381 (UQCRB)
   05016 Huntington's disease
    7381 (UQCRB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7381 (UQCRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P14927(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
8q22.1
AA seq 111 aa AA seqDB search
MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRM
FRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggctggtaagcaggccgtttcagcatcaggcaagtggctggatggtattcgaaaatgg
tattacaatgctgcaggattcaataaactggggttaatgcgagatgatacaatatacgag
gatgaagatgtaaaagaagccataagaagacttcctgagaacctttataatgacaggatg
tttcgcattaagagggcactggacctgaacttgaagcatcagatcttgcctaaagagcag
tggaccaaatatgaagaggaaaatttctaccttgaaccgtatctgaaagaggttattcgg
gaaagaaaagaaagagaagaatgggcaaagaagtaa

KEGG   Homo sapiens (human): 7384Help
Entry
7384              CDS       T01001                                 

Gene name
UQCRC1, D3S3191, QCR1, UQCR1
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 1
  KO
K00414  
ubiquinol-cytochrome c reductase core subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    7384 (UQCRC1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7384 (UQCRC1)
  Environmental adaptation
   04714 Thermogenesis
    7384 (UQCRC1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7384 (UQCRC1)
   05012 Parkinson's disease
    7384 (UQCRC1)
   05016 Huntington's disease
    7384 (UQCRC1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7384 (UQCRC1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   7384 (UQCRC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P31930(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.31
AA seq 480 aa AA seqDB search
MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVA
SEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHL
NAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMR
DVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVC
DRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccgtggtctgtcgggccgctaccgccggggcacaagtgctattgcgcgcc
cgccgctcgccggccctgctgcggacgccagccttgcggagtacggcaaccttcgctcag
gcgctccagttcgtgccggagacgcaggttagcctgctggacaacggcctgcgtgtggcc
tccgagcagtcctctcagcccacttgcacggtgggagtgtggattgatgttggcagccgt
tttgagactgagaagaataatggggcaggctactttttggagcatctggctttcaaggga
acaaagaatcggcctggcagtgccctggagaaggaggtggagagcatgggggcccatctt
aatgcctacagcacccgggagcacacagcttactacatcaaggcgctgtccaaggatctg
ccgaaagctgtggagctcctgggtgacattgtgcagaactgtagtctggaagactcacag
attgagaaggaacgtgatgtgatcctgcgggagatgcaggagaatgatgcatctatgcga
gatgtggtctttaactacctgcatgccacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaatgtcaggaagctgtctcgtgcagacttgaccgagtacctc
agcacacattacaaggcccctcgaatggtgctggcagcagctggaggagtggagcaccag
caactgttagacctcgcccagaagcacctcggtggcatcccatggacatatgcagaggac
gctgtgcccactcttactccatgccgcttcactggcagtgagatccgccaccgtgatgat
gctctaccttttgcccacgtggccattgcagtagagggtcctggctgggccagcccggac
aatgtggccttgcaagtggccaatgccatcatcggccactatgactgcacttatggtggt
ggcgtgcacctgtccagcccactggcttcaggtgctgtggccaacaagctatgccagagt
ttccagaccttcagcatctgctatgcagagacgggcttgctgggtgcacactttgtctgt
gaccgaatgaaaatcgatgacatgatgttcgtcctgcaagggcagtggatgcgcctgtgt
accagtgccacggagagtgaggtggcccggggcaaaaacatcctcagaaatgccctggta
tctcatctagatggcactactcctgtgtgtgaggacatcggacgcagcctcctgacctat
ggccgccgcatccccctggctgaatgggaaagccggattgcggaggtggatgccagtgtg
gtacgtgagatctgctccaagtacatctatgaccagtgcccagcagtggctggatatggc
cccattgagcagctcccagactacaaccggatccgtagcggcatgttctggctgcgcttc
tag

KEGG   Homo sapiens (human): 7385Help
Entry
7385              CDS       T01001                                 

Gene name
UQCRC2, MC3DN5, QCR2, UQCR2
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 2
  KO
K00415  
ubiquinol-cytochrome c reductase core subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    7385 (UQCRC2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7385 (UQCRC2)
  Environmental adaptation
   04714 Thermogenesis
    7385 (UQCRC2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7385 (UQCRC2)
   05012 Parkinson's disease
    7385 (UQCRC2)
   05016 Huntington's disease
    7385 (UQCRC2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7385 (UQCRC2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   7385 (UQCRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P22695(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.2
AA seq 453 aa AA seqDB search
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSR
IGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAA
AYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNM
RGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK
RGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKT
IAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVA
NADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagctactaaccagagccggctctttctcgagattttattccctcaaagttgccccc
aaagttaaagccacagctgcgcctgcaggagcaccgccacaacctcaggaccttgagttt
accaagttaccaaatggcttggtgattgcttctttggaaaactattctcctgtatcaaga
attggtttgttcattaaagcaggcagtagatatgaggacttcagcaatttaggaaccacc
catttgctgcgtcttacatccagtctgacgacaaaaggagcttcatctttcaagataacc
cgtggaattgaagcagttggtggcaaattaagtgtgaccgcaacaagggaaaacatggct
tatactgtggaatgcctgcggggtgatgttgatattctaatggagttcctgctcaatgtc
accacagcaccagaatttcgtcgttgggaagtagctgaccttcagcctcagctaaagatt
gacaaagctgtggcctttcagaatccgcagactcatgtcattgaaaatttgcatgcagca
gcttaccggaatgccttggctaatcccttgtattgtcctgactataggattggaaaagtg
acatcagaggagttacattacttcgttcagaaccatttcacaagtgcaagaatggctttg
attggacttggtgtgagtcatcctgttctaaagcaagttgctgaacagtttctcaacatg
aggggtgggcttggtttatctggtgcaaaggccaactaccgtggaggtgaaatccgagaa
cagaatggagacagtcttgtccatgctgcttttgtagcagaaagtgctgtcgcgggaagt
gcagaggcaaatgcatttagtgttcttcagcatgtcctcggtgctgggccacatgtcaag
aggggcagcaacaccaccagccatctgcaccaggctgttgccaaggcaactcagcagcca
tttgatgtttctgcatttaatgccagttactcagattctggactctttgggatttatact
atctcccaggccacagctgctggagatgttatcaaggctgcctataatcaagtaaaaaca
atagctcaaggaaacctttccaacacagatgtccaagctgccaagaacaagctgaaagct
ggatacctaatgtcagtggagtcttctgagtgtttcctggaagaagtcgggtcccaggct
ctagttgctggttcttacatgccaccatccacagtccttcagcagattgattcagtggct
aatgctgatatcataaatgcggcaaagaagtttgtttctggccagaagtcaatggcagca
agtggaaatttgggacatacaccttttgttgatgagttgtaa

KEGG   Homo sapiens (human): 7386Help
Entry
7386              CDS       T01001                                 

Gene name
UQCRFS1, RIP1, RIS1, RISP, UQCR5
Definition
(RefSeq) ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
  KO
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex respiratory unit
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    7386 (UQCRFS1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7386 (UQCRFS1)
  Environmental adaptation
   04714 Thermogenesis
    7386 (UQCRFS1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7386 (UQCRFS1)
   05012 Parkinson's disease
    7386 (UQCRFS1)
   05016 Huntington's disease
    7386 (UQCRFS1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7386 (UQCRFS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     7386 (UQCRFS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P47985(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q12
AA seq 274 aa AA seqDB search
MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGV
TTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtagcatcccgctcaggcccgttcgcgcccgtcctgtcggccacgtcccgc
ggggtggcgggcgcgctgcggcccttggtgcaggccacggtgcccgccaccccggagcag
cctgtgttggacctgaagcggcccttcctcagccgggagtcgctgagcggccaggccgtg
cgccggcctttggtcgcctccgtgggcctcaatgtccctgcttctgtttgttattcccac
acagacatcaaggtgcctgacttctctgaataccgccgccttgaagttttagatagtacg
aagtcttcaagagaaagcagcgaggctaggaaaggtttctcctatttggtaactggagta
actactgtgggtgtcgcatatgctgccaagaatgccgtcacccagttcgtttccagcatg
agtgcttctgctgatgtgttggccctggcgaaaatcgaaatcaagttatccgatattcca
gaaggcaagaacatggctttcaaatggagaggcaaacccctgtttgtgcgtcatagaacc
cagaaggaaattgagcaggaagctgcagttgaattatcacagttgagggacccacagcat
gatctagatcgagtaaagaaacctgaatgggttatcctgataggtgtttgcactcatctt
ggctgtgtacccattgcaaatgcaggagattttggtggttattactgcccttgccatggg
tcacactatgatgcatctggcaggatcagattgggtcctgctcctctcaaccttgaagtc
cccacgtatgagttcaccagtgacgatatggtgattgttggttaa

KEGG   Homo sapiens (human): 7388Help
Entry
7388              CDS       T01001                                 

Gene name
UQCRH, QCR6, UQCR8
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein
  KO
K00416  
ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    7388 (UQCRH)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7388 (UQCRH)
  Environmental adaptation
   04714 Thermogenesis
    7388 (UQCRH)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7388 (UQCRH)
   05012 Parkinson's disease
    7388 (UQCRH)
   05016 Huntington's disease
    7388 (UQCRH)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7388 (UQCRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P07919(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
1p33
AA seq 91 aa AA seqDB search
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSR
SHTEEDCTEELFDFLHARDHCVAHKLFNNLK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctgtgatgagcgtgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcgagggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

DBGET integrated database retrieval system