KEGG   Homo sapiens (human): 10978Help
Entry
10978             CDS       T01001                                 

Gene name
CLP1, HEAB, hClp1
Definition
(RefSeq) cleavage and polyadenylation factor I subunit 1
  KO
K14399  
polyribonucleotide 5'-hydroxyl-kinase [EC:2.7.1.78]
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Disease
H00897  
Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    10978 (CLP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.78  polynucleotide 5'-hydroxyl-kinase
     10978 (CLP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor IIm (CFIIm)
     10978 (CLP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92989(Tbio)
UniProt: 
Position
11q12.1
AA seq 425 aa AA seqDB search
MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAG
AKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVV
GPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI
QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQ
ALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER
IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRD
MVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR
FMDLK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagaggctaatgatgacaagaagccaaccactaaatttgaactagagcgagaa
acagaacttcgctttgaggtggaggcatctcagtcagttcagttggagttgttgactggc
atggcagagatctttggcacagagctgacccgaaacaagaaattcacctttgatgctggt
gccaaggtggctgttttcacttggcatggctgttctgtgcaactgagcggccgcactgag
gtggcttatgtctccaaggacactcctatgttgctttacctcaacactcacacagccttg
gaacagatgcggaggcaagcggaaaaggaagaagagcgaggtccccgagtgatggtagtg
ggccccactgatgtgggcaagtctacagtgtgtcgccttctgctcaactacgcagtgcgt
ttgggccgccgtcccacttatgtggagctggatgtgggccagggttctgtgtccatccct
ggtaccatgggggccctctacatcgagcggcctgcagatgtcgaagagggtttctctatc
caggcccctctggtgtatcattttggttccaccactcctggcactaacatcaagctttat
aataagattacatctcgtttagcagatgtgttcaaccaaaggtgtgaggtgaaccgaagg
gcatctgtgagtggctgtgtcattaacacctgtggctgggtcaagggctctggttaccag
gctctggtgcatgcagcctcagcttttgaggtggatgtcgttgttgttctggatcaagaa
cgactgtacaatgaactgaaacgggacctcccccactttgtacgcactgtgctgctccct
aaatctgggggtgtggtggagcgctccaaggacttccggcgggaatgtagggatgagcgt
atccgtgagtatttttatggattccgaggctgtttctatccccatgccttcaatgtcaaa
ttttcagatgtgaaaatctacaaagttggggcacccaccatcccagactcctgtttacct
ttgggcatgtctcaagaggataatcagctcaagctagtacctgtcactcctgggcgagat
atggtgcaccacctactgagtgttagcactgccgagggtacagaggagaacctgtccgag
acaagtgtagctggcttcattgtggtgaccagtgtggacctggagcatcaggtgtttact
gttctgtctccagcccctcgcccactgcctaagaacttccttctcatcatggatatccgg
ttcatggatctgaagtag

DBGET integrated database retrieval system