KEGG   Homo sapiens (human): 10991Help
Entry
10991             CDS       T01001                                 

Gene name
SLC38A3, G17, NAT1, SN1
Definition
solute carrier family 38, member 3
Orthology
K13576  
solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    10991 (SLC38A3)
  Nervous system
   04724 Glutamatergic synapse
    10991 (SLC38A3)
   04727 GABAergic synapse
    10991 (SLC38A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
3p21.3
AA seq 504 aa AA seqDB search
MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFT
DFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKS
SGVVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYIIKSELPLVIQTFLNLEE
KTSDWYMNGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFHVPC
PLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQTAYTIPIMAFAFVCH
PEVLPIYTELKDPSKKKMQHISNLSIAVMYIMYFLAALFGYLTFYNGVESELLHTYSKVD
PFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFPNQEFSWLRHVLIAVGLLTCINL
LVIFAPNILGIFGVIGATSAPFLIFIFPAIFYFRIMPTEKEPARSTPKILALCFAMLGFL
LMTMSLSFIIIDWASGTSRHGGNH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcctttgcagacagagatggtggagctggtgcccaatggcaaacactcagag
gggctgctcccggtcatcacccccatggcaggcaaccagagggtcgaggaccctgcacgg
agctgtatggagggcaagagcttcctacagaaaagtcccagcaaggagccacacttcact
gacttcgaggggaagacatcattcgggatgtcagtgttcaacctcagcaatgccatcatg
ggcagcggcatcctgggactcgcctatgccatggccaatacgggcattatccttttcctg
ttcctgttgacagctgtcgccttgctctccagctactccatccacctgctactcaagtcc
tcaggggtcgtgggcatccgtgcctatgagcagctgggctaccgtgcctttgggacccca
ggaaagctggcagcagccctggccatcacgctccagaacatcggagccatgtccagctac
ctgtacatcatcaagtctgagctgccacttgtcatacagaccttcctgaacctggaggag
aaaacctcggactggtacatgaacgggaactacctggtaatccttgtctctgtcaccatc
attctgcccctggcactgatgcggcagcttggctacctgggctactccagcggcttctct
cttagctgcatggtgttcttcctaattgcagtcatctacaaaaagttccacgtgccctgc
ccactgccccccaacttcaacaacaccacaggcaacttcagccacgtggagatcgtgaag
gagaaggtgcagctgcaggtcgagcctgaggcttcagccttctgcactcccagctacttc
acgctcaactcacagacagcatacaccatccccatcatggccttcgccttcgtctgccac
cccgaggtgctgcccatctatactgagctcaaggacccctccaagaagaagatgcagcac
atctccaacctgtccatcgctgtcatgtacatcatgtacttcctggctgccctcttcggc
tacctcaccttctacaacggggtggagtcggagctgctgcacacctacagcaaggtggac
ccgtttgacgtcctgatcctgtgtgtgcgcgtggccgtgctgacagcagtcacgctcaca
gtgcccatcgttctgttcccggtgcgccgcgccatccagcagatgctgtttccaaaccag
gagttcagctggctgcggcatgtgcttattgccgttggcctgctcacttgtatcaacctg
ctggtcatctttgcccccaacatcctgggcatctttggggtcatcggtgccacatctgcc
ccattcctcatcttcatcttccctgccatcttctacttccgaatcatgcccacggagaag
gagcctgcaagatccacccccaaaatcctggccctgtgttttgctatgcttggcttcttg
ctgatgaccatgagcttgagcttcatcatcattgactgggcctcagggaccagccggcat
ggaggaaaccactag

DBGET integrated database retrieval system