KEGG   Homo sapiens (human): 10992Help
Entry
10992             CDS       T01001                                 

Gene name
SF3B2, Cus1, SAP145, SF3B145, SF3b1, SF3b150
Definition
splicing factor 3b, subunit 2, 145kDa
Orthology
K12829  
splicing factor 3B subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U2-snRNP
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 895 aa AA seqDB search
MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQ
TGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFP
MAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQ
QKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDA
RSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGS
DSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPK
KKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREAL
QEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETR
LKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPES
CSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSET
PQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAM
TQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagcatcccgagcctcccaaagcagaattgcagctgccgccgccgccacct
ccaggccactatggcgcctgggctgcccaggagcttcaggccaagttggcagagatcgga
gctccgatccagggtaatcgcgaggagctggtggagcggctgcagagctacacccgccag
actggcatcgtgctgaatcggccggttttgagaggggaagatggggacaaagccgctcca
cctcccatgtcggcacagctccctggaattcccatgccaccaccacctttgggactcccc
cctctgcagcctcctccgccacccccaccacctccaccaggccttggccttggctttcct
atggcccacccaccaaatttggggcccccgcctcctctccgtgtgggtgagccagtggca
ctgtcagaggaggagcggctgaagttggctcagcagcaggcggcattgctgatgcagcag
gaggagcgtgccaagcagcagggagatcattcgctgaaggaacatgagctcttggagcag
cagaagcgggcagctgtgttactggagcaggaacgacagcaggagattgccaagatgggc
accccagtccctcggcccccacaagacatgggccagattggtgtgcgcactcctctgggt
cctcgagtagctgctccagtgggcccagtgggccccactcctacagttttgcccatggga
gcccctgttccccggcctcgtggtcccccaccgccccctggagatgagaacagagagatg
gatgacccctctgtgggccccaagatcccccaggctttggagaagatcctgcagctgaag
gagagccgccaggaagagatgaattctcagcaggaggaagaggaaatggaaacagatgct
cgctcgtccctgggccagtcagcgtcagagactgaggaggacacagtgtccgtatctaaa
aaggagaaaaaccggaagcgtaggaaccgaaagaagaagaaaaagccccagcgggtgcga
ggggtgtcctctgagagctctggggaccgggagaaagactcaacccggtcccgtggctct
gattccccagcagctgatgttgagattgagtatgtgactgaagaacctgaaatttacgag
cccaactttatcttctttaagaggatctttgaggcttttaagctcactgatgatgtgaag
aaggagaaagagaaggagccagagaaacttgacaaactggagaactctgcagcccccaag
aagaagggatttgaagaggagcacaaggacagtgatgatgacagcagtgatgacgagcag
gaaaagaagccagaagcccccaagctgtccaagaagaagttgcgccgaatgaaccgcttc
actgtggctgaactcaagcagctggtggctcggcccgatgtcgtggagatgcacgatgtg
acagcgcaggaccctaagctcttggttcacctcaaggccactcggaactctgtgcctgtg
ccacgccactggtgttttaagcgcaaatacctgcagggcaaacggggcattgagaagccc
cccttcgagctgccagacttcatcaaacgcacaggcatccaggagatgcgagaggccctg
caggagaaggaagaacagaagaccatgaagtcaaaaatgcgagagaaagttcggcctaag
atgggcaaaattgacatcgactaccagaaactgcatgatgccttcttcaagtggcagacc
aagccaaagctgaccatccatggggacctgtactatgaggggaaggagttcgagacacga
ctgaaggagaagaagccaggagatctgtctgatgagctaaggatttccttggggatgcca
gtaggaccaaatgcccacaaggtccctcccccatggctgattgccatgcagcgatatgga
ccacccccatcgtatcccaacctgaaaatccctgggctgaactcgcccatccctgagagc
tgttcctttgggtaccatgctggtggctggggcaaacctccagtggatgagactgggaaa
ccgctctatggggacgtgtttggaaccaatgctgctgaatttcagaccaagactgaggaa
gaagagattgatcggaccccttggggggaactggaaccatctgatgaagaatcctcagaa
gaagaggaagaggaagaaagtgatgaagacaaaccagatgagacaggctttattacccct
gcagacagtggccttatcactcctggaggcttttcatcagtgcctgctggaatggagacc
cctgaactcattgagctgaggaagaagaagattgaggaggcgatggacggaagtgagaca
cctcagctcttcactgtgttgccagagaagagaacagccactgttggaggggccatgatg
ggatcaacccacatttatgacatgtccacggttatgagccggaagggcccggctcctgag
ctgcaaggtgtggaagtggcgctggcgcctgaagagttggagctggatcctatggccatg
acccagaagtatgaggagcatgtgcgggagcagcaggctcaagtagagaaggaggacttc
agtgacatggtggctgagcacgctgccaaacagaagcaaaaaaaacggaaagctcagccc
caggacagccgtgggggcagcaagaaatataaggagttcaagttttag

DBGET integrated database retrieval system