KEGG   Homo sapiens (human): 10998Help
Entry
10998             CDS       T01001                                 

Gene name
SLC27A5, ACSB, ACSVL6, BACS, BAL, FACVL3, FATP-5, FATP5, VLACSR, VLCS-H2, VLCSH2
Definition
solute carrier family 27 (fatty acid transporter), member 5 (EC:6.2.1.7)
Orthology
K08748  
solute carrier family 27 (fatty acid transporter), member 5 [EC:6.2.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Bile secretion
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    10998 (SLC27A5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    10998 (SLC27A5)
  Digestive system
   04976 Bile secretion
    10998 (SLC27A5)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.7  cholate---CoA ligase
     10998 (SLC27A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.43
AA seq 690 aa AA seqDB search
MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWV
PHGLSLAAAALALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAF
ERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVL
ASQAVPALCMWLGLAKLGCPTAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILP
KLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTG
LPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAP
KFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQ
QRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDN
QGFCIPVGLGEPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMD
REGFLYFRDRLGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQ
LAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
PLFVLDNRAQSFRPLTAEMYQAVCEGTWRL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaggcaacagttggccttgctgctgctgctgctgctcctgctctggggcctg
gggcagccagtgtggccagtcgctgtggccttgaccctgcgctggctcctgggggatccc
acatgttgcgtgctacttgggctggccatgttagcacggccctggctcggcccctgggtg
ccccatgggctgagcctggcagctgcggccctggcactaaccctcctgccagcacggctg
cccccaggactacgctggctgccggctgatgtgatcttcttggccaagatcctccacctg
ggcctgaagatcaggggatgcttgagccggcagccgcctgacacctttgtagatgccttc
gagcggcgagcacgagcgcagcctggcagggcactcttggtgtggacggggcctggggcc
ggctcagtcacctttggtgagctggatgcccgggcctgccaggcggcatgggccctgaag
gctgagctgggtgaccctgcgagcctgtgtgccggggagcctactgccctccttgtgctg
gcttcccaggccgttccagccctgtgtatgtggctggggctggccaagctgggctgccca
acagcctggatcaacccgcatggccgggggatgcccctggcgcactctgtgctgagctct
ggggcccgggtgctggtggtggacccagacctccgggagagcctggaggagatccttccc
aagctgcaggctgagaacatccgctgcttctacctcagccatacctcccctacaccaggg
gtgggggctctgggggctgccctggatgcagcgccctcccacccagtgcctgctgacctg
cgtgctgggatcacatggagaagccctgccctcttcatctatacctcggggaccactggc
ctcccgaagccagccatcctcacgcatgagcgggtactgcagatgagcaagatgctgtcc
ttatctggggccacagctgatgatgtggtttacacggtcctgcctctgtaccacgtgatg
ggacttgtcgttgggatcctcggctgcttagatctcggagccacctgtgttctggccccc
aagttctctacttcctgcttctgggatgactgtcggcagcatggcgtgacagtgatcctg
tatgtgggcgagctcctgcggtacttgtgtaacattccccagcaaccagaggaccggaca
catacagtccgcctggcaatgggcaatggactacgggctgatgtgtgggagaccttccag
cagcgcttcggtcctattcggatctgggaagtctacggctccacagaaggcaacatgggc
ttagtcaactatgtggggcgctgcggggccctgggcaagatgagctgcctcctccgaatg
ctgtccccctttgagctggtgcagttcgacatggaggcggcggagcctgtgagggacaat
cagggcttctgcatccctgtagggctaggggagccggggctgctgctgaccaaggtggta
agccagcaacccttcgtgggctaccgcggcccccgagagctgtcggaacggaagctggtg
cgcaacgtgcggcaatcgggcgacgtttactacaacaccggggacgtactggccatggac
cgcgaaggcttcctctacttccgcgaccgcctcggggacaccttccgatggaagggcgag
aacgtgtccacgcacgaggtggagggcgtgttgtcgcaggtggacttcttgcaacaggtt
aacgtgtatggcgtgtgcgtgccaggttgtgagggtaaggtgggcatggctgctgtgcag
ctagcccccggccagactttcgacggggagaagttgtaccagcacgttcgcgcttggctc
cctgcctacgctaccccccatttcatccgcatccaggacgccatggaggtcaccagcacg
ttcaaactgatgaagacccggttggtgcgtgagggcttcaatgtggggatcgtggttgac
cctctgtttgtactggacaaccgggcccagtccttccggcccctgacggcagaaatgtac
caggctgtgtgtgagggaacctggaggctctga

DBGET integrated database retrieval system