KEGG   Homo sapiens (human): 10998Help
Entry
10998             CDS       T01001                                 

Gene name
SLC27A5, ACSB, ACSVL6, BACS, BAL, FACVL3, FATP-5, FATP5, VLACSR, VLCS-H2, VLCSH2
Definition
(RefSeq) solute carrier family 27 member 5 (EC:6.2.1.7)
  KO
K08748  
solute carrier family 27 (fatty acid transporter), member 5 [EC:6.2.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Insulin resistance
Bile secretion
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    10998 (SLC27A5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    10998 (SLC27A5)
  Digestive system
   04976 Bile secretion
    10998 (SLC27A5)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    10998 (SLC27A5)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.7  cholate---CoA ligase
     10998 (SLC27A5)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC27: Fatty acid transporter
   10998 (SLC27A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.43
AA seq 690 aa AA seqDB search
MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWV
PHGLSLAAAALALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAF
ERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVL
ASQAVPALCMWLGLAKLGCPTAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILP
KLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTG
LPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAP
KFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQ
QRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDN
QGFCIPVGLGEPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMD
REGFLYFRDRLGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQ
LAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
PLFVLDNRAQSFRPLTAEMYQAVCEGTWRL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaggcaacagttggccttgctgctgctgctgctgctcctgctctggggcctg
gggcagccagtgtggccagtcgctgtggccttgaccctgcgctggctcctgggggatccc
acatgttgcgtgctacttgggctggccatgttagcacggccctggctcggcccctgggtg
ccccatgggctgagcctggcagctgcggccctggcactaaccctcctgccagcacggctg
cccccaggactacgctggctgccggctgatgtgatcttcttggccaagatcctccacctg
ggcctgaagatcaggggatgcttgagccggcagccgcctgacacctttgtagatgccttc
gagcggcgagcacgagcgcagcctggcagggcactcttggtgtggacggggcctggggcc
ggctcagtcacctttggtgagctggatgcccgggcctgccaggcggcatgggccctgaag
gctgagctgggtgaccctgcgagcctgtgtgccggggagcctactgccctccttgtgctg
gcttcccaggccgttccagccctgtgtatgtggctggggctggccaagctgggctgccca
acagcctggatcaacccgcatggccgggggatgcccctggcgcactctgtgctgagctct
ggggcccgggtgctggtggtggacccagacctccgggagagcctggaggagatccttccc
aagctgcaggctgagaacatccgctgcttctacctcagccatacctcccctacaccaggg
gtgggggctctgggggctgccctggatgcagcgccctcccacccagtgcctgctgacctg
cgtgctgggatcacatggagaagccctgccctcttcatctatacctcggggaccactggc
ctcccgaagccagccatcctcacgcatgagcgggtactgcagatgagcaagatgctgtcc
ttatctggggccacagctgatgatgtggtttacacggtcctgcctctgtaccacgtgatg
ggacttgtcgttgggatcctcggctgcttagatctcggagccacctgtgttctggccccc
aagttctctacttcctgcttctgggatgactgtcggcagcatggcgtgacagtgatcctg
tatgtgggcgagctcctgcggtacttgtgtaacattccccagcaaccagaggaccggaca
catacagtccgcctggcaatgggcaatggactacgggctgatgtgtgggagaccttccag
cagcgcttcggtcctattcggatctgggaagtctacggctccacagaaggcaacatgggc
ttagtcaactatgtggggcgctgcggggccctgggcaagatgagctgcctcctccgaatg
ctgtccccctttgagctggtgcagttcgacatggaggcggcggagcctgtgagggacaat
cagggcttctgcatccctgtagggctaggggagccggggctgctgctgaccaaggtggta
agccagcaacccttcgtgggctaccgcggcccccgagagctgtcggaacggaagctggtg
cgcaacgtgcggcaatcgggcgacgtttactacaacaccggggacgtactggccatggac
cgcgaaggcttcctctacttccgcgaccgcctcggggacaccttccgatggaagggcgag
aacgtgtccacgcacgaggtggagggcgtgttgtcgcaggtggacttcttgcaacaggtt
aacgtgtatggcgtgtgcgtgccaggttgtgagggtaaggtgggcatggctgctgtgcag
ctagcccccggccagactttcgacggggagaagttgtaccagcacgttcgcgcttggctc
cctgcctacgctaccccccatttcatccgcatccaggacgccatggaggtcaccagcacg
ttcaaactgatgaagacccggttggtgcgtgagggcttcaatgtggggatcgtggttgac
cctctgtttgtactggacaaccgggcccagtccttccggcccctgacggcagaaatgtac
caggctgtgtgtgagggaacctggaggctctga

DBGET integrated database retrieval system