KEGG   Homo sapiens (human): 10999Help
Entry
10999             CDS       T01001                                 

Gene name
SLC27A4, ACSVL4, FATP4, IPS
Definition
(RefSeq) solute carrier family 27 member 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
hsa04975  Fat digestion and absorption
Disease
H00741  Ichthyosis prematurity syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    10999 (SLC27A4)
  Digestive system
   04975 Fat digestion and absorption
    10999 (SLC27A4)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    10999 (SLC27A4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     10999 (SLC27A4)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   10999 (SLC27A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC27: Fatty acid transporter
   10999 (SLC27A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 10999
NCBI-ProteinID: NP_005085
OMIM: 604194
HGNC: 10998
Ensembl: ENSG00000167114
Vega: OTTHUMG00000020746
Pharos: Q6P1M0(Tchem)
UniProt: Q6P1M0 A0A024R8D2
Position
9q34.11
AA seq 643 aa AA seqDB search
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
KVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQA
RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
SEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDK
LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG
NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKK
GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE
VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE
LRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttggagcctctctggtgggggtgctgctgttctccaagctggtgctgaaactg
ccctggacccaggtgggattctccctgttgttcctctacttgggatctggcggctggcgc
ttcatccgggtcttcatcaagaccatcaggcgcgatatctttggcggcctggtcctcctg
aaggtgaaggcaaaggtgcgacagtgcctgcaggagcggcggacagtgcccattttgttt
gcctctaccgttcggcgccaccccgacaagacggccctgatcttcgagggcacagatacc
cactggaccttccgccagctggatgagtactcaagcagtgtagccaacttcctgcaggcc
cggggcctggcctcgggcgatgtggctgccatcttcatggagaaccgcaatgagttcgtg
ggcctatggctgggcatggccaagctcggtgtggaggcagccctcatcaacaccaacctg
cggcgggatgctctgctccactgcctcaccacctcgcgcgcacgggcccttgtctttggc
agcgaaatggcctcagccatctgtgaggtccatgccagcctggacccctcgctcagcctc
ttctgctctggctcctgggagcccggtgcggtgcctccaagcacagaacacctggaccct
ctgctgaaagatgctcccaagcaccttcccagttgccctgacaagggcttcacagataaa
ctgttctacatctacacatccggcaccacagggctgcccaaggccgccatcgtggtgcac
agcaggtattaccgcatggctgccctggtgtactatggattccgcatgcggcccaacgac
atcgtctatgactgcctccccctctaccactcagcaggaaacatcgtgggaatcggccag
tgcctgctgcatggcatgacggtggtgattcggaagaagttctcagcctcccggttctgg
gacgattgtatcaagtacaactgcacgattgtgcagtacattggtgaactgtgccgctac
ctcctgaaccagccaccgcgggaggcagaaaaccagcaccaggttcgcatggcactaggc
aatggcctccggcagtccatctggaccaacttttccagccgcttccacataccccaggtg
gctgagttctacggggccacagagtgcaactgtagcctgggcaacttcgacagccaggtg
ggggcctgtggtttcaatagccgcatcctgtccttcgtgtaccccatccggttggtacgt
gtcaacgaggacaccatggagctgatccgggggcccgacggcgtctgcattccctgccag
ccaggtgagccgggccagctggtgggccgcatcatccagaaagaccccctgcgccgcttc
gatggctacctcaaccagggcgccaacaacaagaagattgccaaggatgtcttcaagaag
ggggaccaggcctaccttactggtgatgtgctggtgatggacgagctgggctacctgtac
ttccgagaccgcactggggacacgttccgctggaaaggtgagaacgtgtccaccaccgag
gtggaaggcacactcagccgcctgctggacatggctgacgtggccgtgtatggtgtcgag
gtgccaggaaccgagggccgggccggaatggctgctgtggccagccccactggcaactgt
gacctggagcgctttgctcaggtcttggagaaggaactgcccctgtatgcgcgccccatc
ttcctgcgcctcctgcctgagctgcacaaaacaggaacctacaagttccagaagacagag
ctacggaaggagggctttgacccggctattgtgaaagacccgctgttctatctagatgcc
cagaagggccgctacgtcccgctggaccaagaggcctacagccgcatccaggcaggcgag
gagaagctgtga

DBGET integrated database retrieval system