KEGG   Homo sapiens (human): 10999Help
Entry
10999             CDS       T01001                                 

Gene name
SLC27A4, ACSVL4, FATP4, IPS
Definition
solute carrier family 27 (fatty acid transporter), member 4 (EC:6.2.1.-)
Orthology
K08745  
solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Fat digestion and absorption
Disease
H00741  
Ichthyosis prematurity syndrome
Class
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 643 aa AA seqDB search
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
KVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQA
RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
SEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDK
LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG
NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKK
GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE
VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE
LRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttggagcctctctggtgggggtgctgctgttctccaagctggtgctgaaactg
ccctggacccaggtgggattctccctgttgttcctctacttgggatctggcggctggcgc
ttcatccgggtcttcatcaagaccatcaggcgcgatatctttggcggcctggtcctcctg
aaggtgaaggcaaaggtgcgacagtgcctgcaggagcggcggacagtgcccattttgttt
gcctctaccgttcggcgccaccccgacaagacggccctgatcttcgagggcacagatacc
cactggaccttccgccagctggatgagtactcaagcagtgtagccaacttcctgcaggcc
cggggcctggcctcgggcgatgtggctgccatcttcatggagaaccgcaatgagttcgtg
ggcctatggctgggcatggccaagctcggtgtggaggcagccctcatcaacaccaacctg
cggcgggatgctctgctccactgcctcaccacctcgcgcgcacgggcccttgtctttggc
agcgaaatggcctcagccatctgtgaggtccatgccagcctggacccctcgctcagcctc
ttctgctctggctcctgggagcccggtgcggtgcctccaagcacagaacacctggaccct
ctgctgaaagatgctcccaagcaccttcccagttgccctgacaagggcttcacagataaa
ctgttctacatctacacatccggcaccacagggctgcccaaggccgccatcgtggtgcac
agcaggtattaccgcatggctgccctggtgtactatggattccgcatgcggcccaacgac
atcgtctatgactgcctccccctctaccactcagcaggaaacatcgtgggaatcggccag
tgcctgctgcatggcatgacggtggtgattcggaagaagttctcagcctcccggttctgg
gacgattgtatcaagtacaactgcacgattgtgcagtacattggtgaactgtgccgctac
ctcctgaaccagccaccgcgggaggcagaaaaccagcaccaggttcgcatggcactaggc
aatggcctccggcagtccatctggaccaacttttccagccgcttccacataccccaggtg
gctgagttctacggggccacagagtgcaactgtagcctgggcaacttcgacagccaggtg
ggggcctgtggtttcaatagccgcatcctgtccttcgtgtaccccatccggttggtacgt
gtcaacgaggacaccatggagctgatccgggggcccgacggcgtctgcattccctgccag
ccaggtgagccgggccagctggtgggccgcatcatccagaaagaccccctgcgccgcttc
gatggctacctcaaccagggcgccaacaacaagaagattgccaaggatgtcttcaagaag
ggggaccaggcctaccttactggtgatgtgctggtgatggacgagctgggctacctgtac
ttccgagaccgcactggggacacgttccgctggaaaggtgagaacgtgtccaccaccgag
gtggaaggcacactcagccgcctgctggacatggctgacgtggccgtgtatggtgtcgag
gtgccaggaaccgagggccgggccggaatggctgctgtggccagccccactggcaactgt
gacctggagcgctttgctcaggtcttggagaaggaactgcccctgtatgcgcgccccatc
ttcctgcgcctcctgcctgagctgcacaaaacaggaacctacaagttccagaagacagag
ctacggaaggagggctttgacccggctattgtgaaagacccgctgttctatctagatgcc
cagaagggccgctacgtcccgctggaccaagaggcctacagccgcatccaggcaggcgag
gagaagctgtga

DBGET integrated database retrieval system