KEGG   Homo sapiens (human): 11001Help
Entry
11001             CDS       T01001                                 

Gene name
SLC27A2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1
Definition
(RefSeq) solute carrier family 27 (fatty acid transporter), member 2 (EC:6.2.1.3)
  KO
K08746  
solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Peroxisome
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    11001 (SLC27A2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    11001 (SLC27A2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    11001 (SLC27A2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     11001 (SLC27A2)
    6.2.1.-  
     11001 (SLC27A2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   11001 (SLC27A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21.2
AA seq 567 aa AA seqDB search
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGATLALRTKFS
ASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRF
GDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGY
CVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHEN
FIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKE
NHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALY
FLDDTAKMYVPMTEDIYNAISAKTLKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgctttccgccatctacacagtcctggcgggactgctgttcctgccgctcctggtgaac
ctctgctgcccatacttcttccaggacataggctacttcttgaaggtggccgccgtgggc
cggagggtgcgcagctacgggaagcggcggccggcgcgcaccatcctgcgggcgttcctg
gagaaagcgcgccagacgccacacaagccttttctgctcttccgcgacgagactctcacc
tacgcgcaggtggaccggcgcagcaatcaagtggcccgggcgctgcacgaccacctcggc
ctgcgccagggagactgcgtggcgctccttatgggtaacgagccggcctacgtgtggctg
tggctggggctggtgaagctgggctgtgccatggcgtgcctcaattacaacatccgcgcg
aagtccctgctgcactgcttccagtgctgcggggcgaaggtgctgctggtgtcgccagaa
ctacaagcagctgtcgaagagatactgccaagccttaaaaaagatgatgtgtccatctat
tatgtgagcagaacttctaacacagatgggattgactctttcctggacaaagtggatgaa
gtatcaactgaacctatcccagagtcatggaggtctgaagtcactttttccactcctgcc
ttatacatttatacttctggaaccacaggtgctactcttgccttgcggactaaattttca
gccagccagttttgggatgactgcagaaaatacaacgtcactgtcattcagtatatcggt
gaactgcttcggtatttatgcaactcaccacagaaaccaaatgaccgtgatcataaagtg
agactggcactgggaaatggcttacgaggagatgtgtggagacaatttgtcaagagattt
ggggacatatgcatctatgagttctatgctgccactgaaggcaatattggatttatgaat
tatgcgagaaaagttggtgctgttggaagagtaaactacctacagaaaaaaatcataact
tatgacctgattaaatatgatgtggagaaagatgaacctgtccgtgatgaaaatggatat
tgcgtcagagttcccaaaggtgaagttggacttctggtttgcaaaatcacacaacttaca
ccatttaatggctatgctggagcaaaggctcagacagagaagaaaaaactgagagatgtc
tttaagaaaggagacctctatttcaacagtggagatctcttaatggttgaccatgaaaat
ttcatctatttccacgacagagttggagatacattccggtggaaaggggaaaatgtggcc
accactgaagttgctgatacagttggactggttgattttgtccaagaagtaaatgtttat
ggagtgcatgtgccagatcatgagggtcgcattggcatggcctccatcaaaatgaaagaa
aaccatgaatttgatggaaagaaactctttcagcacattgctgattacctacctagttat
gcaaggccccggtttctaagaatacaggacaccattgagatcactggaacttttaaacac
cgcaaaatgaccctggtggaggagggctttaaccctgctgtcatcaaagatgccttgtat
ttcttggatgacacagcaaaaatgtatgtgcctatgactgaggacatctataatgccata
agtgctaaaaccctgaaactctga

DBGET integrated database retrieval system