KEGG   Homo sapiens (human): 11001Help
Entry
11001             CDS       T01001                                 

Gene name
SLC27A2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1
Definition
solute carrier family 27 (fatty acid transporter), member 2 (EC:6.2.1.3)
Orthology
K08746  
solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    11001 (SLC27A2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    11001 (SLC27A2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     11001 (SLC27A2)
    6.2.1.-  
     11001 (SLC27A2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   11001 (SLC27A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21.2
AA seq 567 aa AA seqDB search
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGATLALRTKFS
ASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRF
GDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGY
CVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHEN
FIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKE
NHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALY
FLDDTAKMYVPMTEDIYNAISAKTLKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgctttccgccatctacacagtcctggcgggactgctgttcctgccgctcctggtgaac
ctctgctgcccatacttcttccaggacataggctacttcttgaaggtggccgccgtgggc
cggagggtgcgcagctacgggaagcggcggccggcgcgcaccatcctgcgggcgttcctg
gagaaagcgcgccagacgccacacaagccttttctgctcttccgcgacgagactctcacc
tacgcgcaggtggaccggcgcagcaatcaagtggcccgggcgctgcacgaccacctcggc
ctgcgccagggagactgcgtggcgctccttatgggtaacgagccggcctacgtgtggctg
tggctggggctggtgaagctgggctgtgccatggcgtgcctcaattacaacatccgcgcg
aagtccctgctgcactgcttccagtgctgcggggcgaaggtgctgctggtgtcgccagaa
ctacaagcagctgtcgaagagatactgccaagccttaaaaaagatgatgtgtccatctat
tatgtgagcagaacttctaacacagatgggattgactctttcctggacaaagtggatgaa
gtatcaactgaacctatcccagagtcatggaggtctgaagtcactttttccactcctgcc
ttatacatttatacttctggaaccacaggtgctactcttgccttgcggactaaattttca
gccagccagttttgggatgactgcagaaaatacaacgtcactgtcattcagtatatcggt
gaactgcttcggtatttatgcaactcaccacagaaaccaaatgaccgtgatcataaagtg
agactggcactgggaaatggcttacgaggagatgtgtggagacaatttgtcaagagattt
ggggacatatgcatctatgagttctatgctgccactgaaggcaatattggatttatgaat
tatgcgagaaaagttggtgctgttggaagagtaaactacctacagaaaaaaatcataact
tatgacctgattaaatatgatgtggagaaagatgaacctgtccgtgatgaaaatggatat
tgcgtcagagttcccaaaggtgaagttggacttctggtttgcaaaatcacacaacttaca
ccatttaatggctatgctggagcaaaggctcagacagagaagaaaaaactgagagatgtc
tttaagaaaggagacctctatttcaacagtggagatctcttaatggttgaccatgaaaat
ttcatctatttccacgacagagttggagatacattccggtggaaaggggaaaatgtggcc
accactgaagttgctgatacagttggactggttgattttgtccaagaagtaaatgtttat
ggagtgcatgtgccagatcatgagggtcgcattggcatggcctccatcaaaatgaaagaa
aaccatgaatttgatggaaagaaactctttcagcacattgctgattacctacctagttat
gcaaggccccggtttctaagaatacaggacaccattgagatcactggaacttttaaacac
cgcaaaatgaccctggtggaggagggctttaaccctgctgtcatcaaagatgccttgtat
ttcttggatgacacagcaaaaatgtatgtgcctatgactgaggacatctataatgccata
agtgctaaaaccctgaaactctga

DBGET integrated database retrieval system