KEGG   Homo sapiens (human): 11006Help
Entry
11006             CDS       T01001                                 

Gene name
LILRB4, CD85K, ILT-3, ILT3, LIR-5, LIR5
Definition
(RefSeq) leukocyte immunoglobulin like receptor B4
  KO
K06512  
leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    11006 (LILRB4)
Cellular antigens [BR:hsa04090]
 Proteins
  11006 (LILRB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NHJ6(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 448 aa AA seqDB search
MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRL
DKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGA
YSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEF
PMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEGPRPSPTRSVSTAAGPED
QPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR
PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTY
AKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYARLHSFTL
RQKATEPPPSQEGASPAEPSVYATLAIH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgatccccaccttcacggctctgctctgcctcgggctgagtctgggccccaggacccac
atgcaggcagggcccctccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggaactctgtgaccatctggtgtcaggggaccctggaggctcgggagtaccgtctg
gataaagaggaaagcccagcaccctgggacagacagaacccactggagcccaagaacaag
gccagattctccatcccatccatgacagaggactatgcagggagataccgctgttactat
cgcagccctgtaggctggtcacagcccagtgaccccctggagctggtgatgacaggagcc
tacagtaaacccaccctttcagccctgccgagtcctcttgtgacctcaggaaagagcgtg
accctgctgtgtcagtcacggagcccaatggacacttttcttctgatcaaggagcgggca
gcccatcccctactgcatctgagatcagagcacggagctcagcagcaccaggctgaattc
cccatgagtcctgtgacctcagtgcacggggggacctacaggtgcttcagctcacacggc
ttctcccactacctgctgtcacaccccagtgaccccctggagctcatagtctcaggatcc
ttggagggtcccaggccctcacccacaaggtccgtctcaacagctgcaggccctgaggac
cagcccctcatgcctacagggtcagtcccccacagtggtctgagaaggcactgggaggta
ctgatcggggtcttggtggtctccatcctgcttctctccctcctcctcttcctcctcctc
caacactggcgtcagggaaaacacaggacattggcccagagacaggctgatttccaacgt
cctccaggggctgccgagccagagcccaaggacgggggcctacagaggaggtccagccca
gctgctgacgtccagggagaaaacttctgtgctgccgtgaagaacacacagcctgaggac
ggggtggaaatggacactcggcagagcccacacgatgaagacccccaggcagtgacgtat
gccaaggtgaaacactccagacctaggagagaaatggcctctcctccctccccactgtct
ggggaattcctggacacaaaggacagacaggcagaagaggacagacagatggacactgag
gctgctgcatctgaagccccccaggatgtgacctacgcccggctgcacagctttaccctc
agacagaaggcaactgagcctcctccatcccaggaaggggcctctccagctgagcccagt
gtctatgccactctggccatccactaa

DBGET integrated database retrieval system