KEGG   Homo sapiens (human): 1101Help
Entry
1101              CDS       T01001                                 

Gene name
CHAD, SLRR4A
Definition
chondroadherin
Orthology
K06248  
chondroadherin
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.33
AA seq 359 aa AA seqDB search
MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQR
NNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFD
DLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSE
NALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQ
SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNN
PWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcccaatgctcttgctcagcctcggcctcctggctggtctgctgccggcgctg
gccgcctgcccccagaactgccactgccacagcgacctgcagcacgtcatctgcgacaag
gtggggctgcagaagatccccaaggtgtcagagaagaccaagctgctcaacctacagcgc
aacaacttcccggtgctggctgccaattcgttccgggccatgccgaacctcgtgtcattg
cacctgcagcactgccagatccgcgaggtggccgccggtgccttccgcggcctcaagcaa
cttatctacttgtacctgtcccataacgacatccgcgtgctgcgcgcaggtgccttcgac
gacctgaccgagctgacctacctctacctggaccacaacaaggtcactgagctgccccgg
gggttgctctccccgctggtcaacctcttcatcttgcagctcaacaacaacaagatccgt
gagctgcgcgcaggcgccttccagggagccaaggacctgcgctggctctacctgtcggaa
aacgcgttgagctccctgcagcccggggccctggacgacgtggagaacctcgccaaattc
cacgtggacaggaaccagctgtccagctacccctcagctgccctgagcaagctacgggtg
gtggaggagctgaagctgtcccacaaccccctgaaaagcatcccggacaatgccttccag
tcctttggcagatacctggagaccctctggctggacaacaccaacctggagaagttctca
gatggtgccttcctgggtgtaaccacgctgaaacacgtccatttggagaacaaccgcttg
aaccagctaccctccaacttccccttcgacagcctggagaccctcgcccttaccaataac
ccctggaagtgtacctgccagctccggggccttcggcggtggctggaagccaaggcctcc
cgcccagatgccacctgtgcctcacctgccaagttcaagggccagcacatccgtgacacg
gacgccttccgcagctgcaagttccccaccaagaggtccaagaaagctggccgccattaa

DBGET integrated database retrieval system