KEGG   Homo sapiens (human): 11012Help
Entry
11012             CDS       T01001                                 

Gene name
KLK11, PRSS20, TLSP
Definition
kallikrein-related peptidase 11
Orthology
K09620  
kallikrein 11 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 250 aa AA seqDB search
MRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTA
AHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPV
SITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPG
NITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYV
DWIQETMKNN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggattctgcagttaatcctgcttgctctggcaacagggcttgtagggggagagacc
aggatcatcaaggggttcgagtgcaagcctcactcccagccctggcaggcagccctgttc
gagaagacgcggctactctgtggggcgacgctcatcgcccccagatggctcctgacagca
gcccactgcctcaagccccgctacatagttcacctggggcagcacaacctccagaaggag
gagggctgtgagcagacccggacagccactgagtccttcccccaccccggcttcaacaac
agcctccccaacaaagaccaccgcaatgacatcatgctggtgaagatggcatcgccagtc
tccatcacctgggctgtgcgacccctcaccctctcctcacgctgtgtcactgctggcacc
agctgcctcatttccggctggggcagcacgtccagcccccagttacgcctgcctcacacc
ttgcgatgcgccaacatcaccatcattgagcaccagaagtgtgagaacgcctaccccggc
aacatcacagacaccatggtgtgtgccagcgtgcaggaagggggcaaggactcctgccag
ggtgactccgggggccctctggtctgtaaccagtctcttcaaggcattatctcctggggc
caggatccgtgtgcgatcacccgaaagcctggtgtctacacgaaagtctgcaaatatgtg
gactggatccaggagacgatgaagaacaattag

DBGET integrated database retrieval system