KEGG   Homo sapiens (human): 11012Help
Entry
11012             CDS       T01001                                 

Gene name
KLK11, PRSS20, TLSP
Definition
(RefSeq) kallikrein related peptidase 11
  KO
K09620  
kallikrein 11 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     11012 (KLK11)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   11012 (KLK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 282 aa AA seqDB search
MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFEC
KPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRT
ATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWG
STSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLV
CNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggttgaggtggctgcgggactggaagtcatcgggcagaggtctcacagcagcc
aaggaacctggggcccgctcctcccccctccaggccatgaggattctgcagttaatcctg
cttgctctggcaacagggcttgtagggggagagaccaggatcatcaaggggttcgagtgc
aagcctcactcccagccctggcaggcagccctgttcgagaagacgcggctactctgtggg
gcgacgctcatcgcccccagatggctcctgacagcagcccactgcctcaagccccgctac
atagttcacctggggcagcacaacctccagaaggaggagggctgtgagcagacccggaca
gccactgagtccttcccccaccccggcttcaacaacagcctccccaacaaagaccaccgc
aatgacatcatgctggtgaagatggcatcgccagtctccatcacctgggctgtgcgaccc
ctcaccctctcctcacgctgtgtcactgctggcaccagctgcctcatttccggctggggc
agcacgtccagcccccagttacgcctgcctcacaccttgcgatgcgccaacatcaccatc
attgagcaccagaagtgtgagaacgcctaccccggcaacatcacagacaccatggtgtgt
gccagcgtgcaggaagggggcaaggactcctgccagggtgactccgggggccctctggtc
tgtaaccagtctcttcaaggcattatctcctggggccaggatccgtgtgcgatcacccga
aagcctggtgtctacacgaaagtctgcaaatatgtggactggatccaggagacgatgaag
aacaattag

DBGET integrated database retrieval system