KEGG   Homo sapiens (human): 1103Help
Entry
1103              CDS       T01001                                 

Gene name
CHAT, CHOACTASE, CMS1A, CMS1A2
Definition
choline O-acetyltransferase (EC:2.3.1.6)
Orthology
K00623  
choline O-acetyltransferase [EC:2.3.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Disease
H00770  
Congenital myasthenic syndrome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11.2
AA seq 630 aa AA seqDB search
MAAKTPSSEESGLPKLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGET
LQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASL
ISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIM
PEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGR
SEWAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGA
NRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELP
APRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVA
LQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLL
LLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTS
QVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDM
RDLCSLLPPTESKPLATKEKATRPSQGHQP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaaaactcccagcagtgaggagtctgggctgcccaaactgcccgtgcccccg
ctgcagcagaccctggccacgtacctgcagtgcatgcgacacttggtgtctgaggagcag
ttcaggaagagccaggccattgtgcagcagtttggggcccctggtggcctcggcgagacc
ctgcagcagaaactcctggagcggcaggagaagacagccaactgggtgtctgagtactgg
ctgaatgacatgtatctcaacaaccgcctggccctgcctgtcaactccagccctgccgtg
atctttgctcggcagcacttccctggcaccgatgaccagctgaggtttgcagccagcctc
atctctggtgtactcagctacaaggccctgctggacagccactccattcccactgactgt
gccaaaggccagctgtcagggcagcccctttgcatgaagcaatactatgggctcttctcc
tcctaccggctccccggccatacccaggacacgctggtggctcagaacagcagcatcatg
ccggagcctgagcacgtcatcgtagcctgctgcaatcagttctttgtcttggatgttgtc
attaatttccgccgtctcagtgagggggatctgttcactcagttgagaaagatagtcaaa
atggcttccaacgaggacgagcgtttgcctccaattggcctgctgacgtctgacgggagg
agcgagtgggccgaggccaggacggtcctcgtgaaagactccaccaaccgggactcgctg
gacatgattgagcgctgcatctgccttgtatgcctggacgcgccaggaggcgtggagctc
agcgacacccacagggcactccagctccttcacggcggaggctacagcaagaacggggcc
aatcgctggtacgacaagtccctgcagtttgtggtgggccgagacggcacctgcggtgtg
gtgtgcgaacactccccattcgatggcatcgtcctggtgcagtgcactgagcatctgctc
aagcacatgacgcagagcagcaggaagctgatccgagcagactccgtcagcgagctcccc
gccccccggaggctgcggtggaaatgctccccggaaattcaaggccacttagcctcctcg
gcagaaaaacttcaacgaatagtaaagaaccttgacttcattgtctataagtttgacaac
tatgggaaaacattcattaagaagcagaaatgcagccctgatgccttcatccaggtggcc
ctccagctggccttctacaggctccatcgaagactggtgcccacctacgagagcgcgtcc
atccgccgattccaggagggacgcgtggacaacatcagatcggccactccagaggcactg
gcttttgtgagagccgtgactgaccacaaggctgctgtgccagcttctgagaagcttctg
ctcctgaaggatgccatccgtgcccagactgcatacacagtcatggccataacagggatg
gccattgacaaccacctgctggcactgcgggagctggcccgggccatgtgcaaggagctg
cccgagatgttcatggatgaaacctacctgatgagcaaccggtttgtcctctccactagc
caggtgcccacaaccacggagatgttctgctgctatggtcctgtggtcccaaatgggtat
ggtgcctgctacaacccccagccagagaccatccttttctgcatctctagctttcacagc
tgcaaagagacttcttctagcaagtttgcaaaagctgtggaagaaagcctcattgacatg
agagacctctgcagtctgctgccgcctactgagagcaagccattggcaacaaaggaaaaa
gccacgaggcccagccagggacaccaaccttga

DBGET integrated database retrieval system