KEGG   Homo sapiens (human): 11034Help
Entry
11034             CDS       T01001                                 

Gene name
DSTN, ACTDP, ADF, HEL32, bA462D18.2
Definition
(RefSeq) destrin, actin depolymerizing factor
  KO
K10363  
destrin (actin-depolymerizing factor)
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     11034 (DSTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p12.1
AA seq 165 aa AA seqDB search
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDV
GVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASS
KDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaggagtgcaagtagctgatgaagtatgtcgcattttttatgacatgaaagtt
cgtaaatgctccacaccagaagaaatcaagaaaagaaagaaggctgtcattttttgtctc
agtgcagacaaaaagtgcatcattgtagaagaaggcaaagagatcttggttggagatgtt
ggtgtaaccataactgatcctttcaagcattttgtgggaatgcttcctgaaaaagattgt
cgctatgctttgtatgatgcaagctttgaaacaaaagaatccagaaaagaagagttgatg
ttttttttgtgggcaccagaactagcacctctgaaaagtaaaatgatctatgcaagctcc
aaggatgcaattaaaaagaaatttcaaggcataaaacatgaatgtcaagcaaatggacca
gaagatctcaatcgggcttgtattgctgaaaagttaggtggatccttaattgtagccttt
gaaggatgccctgtgtag

DBGET integrated database retrieval system