KEGG   Homo sapiens (human): 11040Help
Entry
11040             CDS       T01001                                 

Gene name
PIM2
Definition
(RefSeq) Pim-2 proto-oncogene, serine/threonine kinase (EC:2.7.11.1)
  KO
K08806  
proto-oncogene serine/threonine-protein kinase Pim-2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05221 Acute myeloid leukemia
    11040 (PIM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11040 (PIM2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  PIM family [OT]
   11040 (PIM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 311 aa AA seqDB search
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccaagcctctacaggggcctcccgcgccccccgggacccccacgccgccgcca
ggaggcaaggatcgggaagcgttcgaggccgagtatcgactcggccccctcctgggtaag
gggggctttggcaccgtcttcgcaggacaccgcctcacagatcgactccaggtggccatc
aaagtgattccccggaatcgtgtgctgggctggtcccccttgtcagactcagtcacatgc
ccactcgaagtcgcactgctatggaaagtgggtgcaggtggtgggcaccctggcgtgatc
cgcctgcttgactggtttgagacacaggagggcttcatgctggtcctcgagcggcctttg
cccgcccaggatctctttgactatatcacagagaagggcccactgggtgaaggcccaagc
cgctgcttctttggccaagtagtggcagccatccagcactgccattcccgtggagttgtc
catcgtgacatcaaggatgagaacatcctgatagacctacgccgtggctgtgccaaactc
attgattttggttctggtgccctgcttcatgatgaaccctacactgactttgatgggaca
agggtgtacagccccccagagtggatctctcgacaccagtaccatgcactcccggccact
gtctggtcactgggcatcctcctctatgacatggtgtgtggggacattccctttgagagg
gaccaggagattctggaagctgagctccacttcccagcccatgtctccccagactgctgt
gccctaatccgccggtgcctggcccccaaaccttcttcccgaccctcactggaagagatc
ctgctggacccctggatgcaaacaccagccgaggatgtacccctcaacccctccaaagga
ggccctgcccctttggcctggtccttgctaccctaa

DBGET integrated database retrieval system