KEGG   Homo sapiens (human): 11046Help
Entry
11046             CDS       T01001                                 

Gene name
SLC35D2, HFRC1, SQV7L, UGTrel8, hfrc
Definition
(RefSeq) solute carrier family 35 member D2
  KO
K15281  
solute carrier family 35
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   11046 (SLC35D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q22.32
AA seq 337 aa AA seqDB search
MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIFL
GIGQMAATIMILYVSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMF
TVLRKFTIPLTLLLETIILGKQYSLNIILSVFAIILGAFIAAGSDLAFNLEGYIFVFLND
IFTAANGVYTKQKMDPKELGKYGVLFYNACFMIIPTLIISVSTGDLQQATEFNQWKNVVF
ILQFLLSCFLGFLLMYSTVLCSYYNSALTTAVVGAIKNVSVAYIGILIGGDYIFSLLNFV
GLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacggccggcggccaggccgaggccgagggcgctggcggggagcccggcgcggcgcgg
ctgccctcgcgggtggcccggctgctgtcggcgctcttctacgggacctgctccttcctc
atcgtgcttgtcaacaaggcgctgctgaccacctacggtttcccgtcaccaattttcctt
ggaattggacagatggcagccaccataatgatactatatgtgtccaagctaaacaaaatc
attcacttccctgattttgataagaaaattcctgtaaagctgtttcctctgcctctcctc
tacgttggaaaccacataagtggattatcaagcacaagtaaattaagcctaccgatgttc
accgtgctcaggaaattcaccattccacttaccttacttctggaaaccatcatacttggg
aagcagtattcactcaacatcatcctcagtgtctttgccattattctcggggctttcata
gcagctgggtctgaccttgcttttaacttagaaggctatatttttgtattcctgaatgat
atcttcacagcagcaaatggagtttataccaaacagaaaatggacccaaaggagctaggg
aaatacggagtacttttctacaatgcctgcttcatgattatcccaactcttattattagt
gtctccactggagacctgcaacaggctactgaattcaaccaatggaagaatgttgtgttt
atcctacagtttcttctttcctgttttttggggtttctgctgatgtactccacggttctg
tgcagctattacaattcagccctgacgacagcagtggttggagccatcaagaatgtatcc
gttgcctacattgggatattaatcggtggagactacattttctctttgttaaactttgta
gggttaaatatttgcatggcagggggcttgagatattcctttttaacactgagcagccag
ttaaaacctaaacctgtgggtgaagaaaacatctgtttggatttgaagagctaa

DBGET integrated database retrieval system