KEGG   Homo sapiens (human): 11051Help
Entry
11051             CDS       T01001                                 

Gene name
NUDT21, CFIM25, CPSF5
Definition
(RefSeq) nudix hydrolase 21
  KO
K14397  
cleavage and polyadenylation specificity factor subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    11051 (NUDT21)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     11051 (NUDT21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O43809(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16q13
AA seq 227 aa AA seqDB search
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
AARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEG
LKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQ
EKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggtaccgcccaatcgctcgcagaccggctggccccggggggtcactcagttc
ggcaacaagtacatccagcagacgaagcccctcaccctggagcgcaccatcaacctgtac
cctcttaccaattatacttttggtacaaaagagcccctctacgagaaggacagctctgtt
gcagccagatttcagcgcatgagggaagaatttgataaaattggaatgaggaggactgta
gaaggggttctgattgtacatgagcaccggctaccccatgtgttactgctgcagctggga
acaactttcttcaaactacctggtggtgaacttaacccaggagaagatgaagttgaagga
ctaaaacgcttaatgacagagatactgggtcgtcaggatggagttttgcaagactgggtc
attgacgattgcattggtaactggtggagaccaaattttgaacctcctcagtatccatat
attcctgcacatattacaaagcctaaggaacataagaagttgtttctggttcagcttcaa
gaaaaagccttgtttgcagtccctaaaaattacaagctggtagctgcaccattgtttgaa
ttgtatgacaatgcaccaggatatggacccatcatttctagtctccctcagctgttgagc
aggttcaattttatttacaactga

DBGET integrated database retrieval system