KEGG   Homo sapiens (human): 11052Help
Entry
11052             CDS       T01001                                 

Gene name
CPSF6, CFIM, CFIM68, HPBRII-4, HPBRII-7
Definition
cleavage and polyadenylation specific factor 6, 68kDa
Orthology
K14398  
cleavage and polyadenylation specificity factor subunit 6/7
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    11052 (CPSF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q15
AA seq 588 aa AA seqDB search
MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTV
GDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRAN
GQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQM
SGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPGNLIKHLVK
GTRPLFLETRIPWHMGHSIEEIPIFGLKAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPL
AGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPF
PPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNSGMPTSDSRGPPPTDP
YGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNRNRAISSSAISRAVSDASAGDYGS
AIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSRRERSRERDHSRSR
EKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDRERDREREYRHR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggcgtggaccacatagacatttacgcggatgtcggcgaagagttcaaccag
gaagctgaatatggtgggcatgatcagatagatttgtatgacgatgtcatatctccatct
gcaaataatggagatgccccagaagaccgagattacatggatactctcccaccaactgtt
ggtgatgatgtgggtaaaggagcagcaccaaatgttgtctatacatatactggaaagaga
attgcattatatattggaaatctaacatggtggacaacagatgaagacttaactgaagca
gttcattctttgggagtaaatgatattttggagataaaattttttgaaaatcgggcaaat
ggccagtcaaaggggtttgcccttgttggtgttggatctgaagcatcttcaaaaaagtta
atggatctgttacctaaaagagaacttcatggtcagaatcctgttgtaactccatgcaat
aaacagttcctgagtcaatttgaaatgcagtccaggaaaactacacaatcaggacaaatg
tctggggaaggtaaagctggtcctccaggaggcagttcccgtgcagcatttccacaaggt
ggtagaggacggggccgttttccaggggctgttcctggtggggacagatttcctgggcca
gcaggaccaggagggccacccccaccttttccaggaaatttgatcaagcatcttgttaaa
ggaactcggcctttgttcctggaaactaggattccatggcatatggggcacagcatagag
gaaatacccatttttggcctaaaagctggacagactccaccacgtccacccttaggtcct
ccaggcccacctggtccaccaggtcctccacctcctggtcaggttctgcctcctcctcta
gctgggcctcctaatcgaggagatcgccctccaccaccagttctttttcctggacaacct
tttgggcagcctccattgggtccacttcctcctggccctccacctccagttccaggctac
ggcccccctcctggcccaccacctccacaacagggaccacctccacctccaggccccttt
ccacctcgtccacccggtccacttgggccaccccttacactagctcctcctccgcatctt
cctggaccacctccaggtgccccaccgccagctccgcatgtgaacccagctttctttcct
ccaccaactaacagtggcatgcctacatcagatagccgaggtccaccaccaacagatcca
tatgggcgacctccaccatatgataggggtgactatggcccccctggaagggaaatggat
actgcaagaacgccattgagtgaagctgaatttgaagaaatcatgaatagaaatagggca
atctcaagcagtgctatttcgagagctgtgtctgatgccagtgctggtgattatgggagt
gctattgagacactggtaactgcaatttctttaattaaacaatccaaagtatctgctgat
gatcgttgcaaagttcttattagttctttgcaagattgccttcatggaattgagtccaag
tcttatggttctggatcaagacgtgaacgatcaagagagagggaccatagtagatcacga
gaaaagagtcgacgtcataaatcccgtagtagagaccgtcatgacgattattacagagag
agaagcagagaacgagagaggcaccgggatcgtgaccgagaccgtgaccgagagcgtgac
cgagagcgcgaatatcgtcatcgttag

DBGET integrated database retrieval system