KEGG   Homo sapiens (human): 11059Help
Entry
11059             CDS       T01001                                 

Gene name
WWP1, AIP5, Tiul1, hSDRP1
Definition
WW domain containing E3 ubiquitin protein ligase 1
Orthology
K05633  
atrophin-1 interacting protein 5 (WW domain containing E3 ubiquitin protein ligase 1) [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11059 (WWP1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    11059 (WWP1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     11059 (WWP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21
AA seq 922 aa AA seqDB search
MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSS
NPKWDEQLTVNVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLK
LSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTAR
LAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADD
TVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTS
AELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTETLPSGWEQRKD
PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
IAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
SYEQLKEKLLFAIEETEGFGQE
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcttcaccaaggtctgatactagtaataaccacagtggaaggttgcagtta
caggtaactgtttctagtgccaaacttaaaagaaaaaagaactggttcggaacagcaata
tatacagaagtagttgtagatggagaaattacgaaaacagcaaaatccagtagttcttct
aatccaaaatgggatgaacagctaactgtaaatgttacgccacagactacattggaattt
caagtttggagccatcgcactttaaaagcagatgctttattaggaaaagcaacgatagat
ttgaaacaagctctgttgatacacaatagaaaattggaaagagtgaaagaacaattaaaa
ctttccttggaaaacaagaatggcatagcacaaactggtgaattgacagttgtgcttgat
ggattggtgattgagcaagaaaatataacaaactgcagctcatctccaaccatagaaata
caggaaaatggtgatgccttacatgaaaatggagagccttcagcaaggacaactgccagg
ttggctgttgaaggcacgaatggaatagataatcatgtacctacaagcactctagtccaa
aactcatgctgctcgtatgtagttaatggagacaacacaccttcatctccgtctcaggtt
gctgccagacccaaaaatacaccagctccaaaaccactcgcatctgagcctgccgatgac
actgttaatggagaatcatcctcatttgcaccaactgataatgcgtctgtcacgggtact
ccagtagtgtctgaagaaaatgccttgtctccaaattgcactagtactactgttgaagat
cctccagttcaagaaatactgacttcctcagaaaacaatgaatgtattccttctaccagt
gcagaattggaatctgaagctagaagtatattagagcctgacacctctaattctagaagt
agttctgcttttgaagcagccaaatcaagacagccagatgggtgtatggatcctgtacgg
cagcagtctgggaatgccaacacagaaaccttgccatcagggtgggaacaaagaaaagat
cctcatggtagaacctattatgtggatcataatactcgaactaccacatgggagagacca
caacctttacctccaggttgggaaagaagagttgatgatcgtagaagagtttattatgtg
gatcataacaccagaacaacaacgtggcagcggcctaccatggaatctgtccgaaatttt
gaacagtggcaatctcagcggaaccaattgcagggagctatgcaacagtttaaccaacga
tacctctattcggcttcaatgttagctgcagaaaatgacccttatggacctttgccacca
ggctgggaaaaaagagtggattcaacagacagggtttactttgtgaatcataacacaaaa
acaacccagtgggaagatccaagaactcaaggcttacagaatgaagaacccctgccagaa
ggctgggaaattagatatactcgtgaaggtgtaaggtactttgttgatcataacacaaga
acaacaacattcaaagatcctcgcaatgggaagtcatctgtaactaaaggtggtccacaa
attgcttatgaacgcggctttaggtggaagcttgctcacttccgttatttgtgccagtct
aatgcactacctagtcatgtaaagatcaatgtgtcccggcagacattgtttgaagattcc
ttccaacagattatggcattaaaaccctatgacttgaggaggcgcttatatgtaatattt
agaggagaagaaggacttgattatggtggcctagcgagagaatggtttttcttgctttca
catgaagttttgaacccaatgtattgcttatttgagtatgcgggcaagaacaactattgt
ctgcagataaatccagcatcaaccattaatccagaccatctttcatacttctgtttcatt
ggtcgttttattgccatggcactatttcatggaaagtttatcgatactggtttctcttta
ccattctacaagcgtatgttaagtaaaaaacttactattaaggatttggaatctattgat
actgaattttataactcccttatctggataagagataacaacattgaagaatgtggctta
gaaatgtacttttctgttgacatggagattttgggaaaagttacttcacatgacctgaag
ttgggaggttccaatattctggtgactgaggagaacaaagatgaatatattggtttaatg
acagaatggcgtttttctcgaggagtacaagaacagaccaaagctttccttgatggtttt
aatgaagttgttcctcttcagtggctacagtacttcgatgaaaaagaattagaggttatg
ttgtgtggcatgcaggaggttgacttggcagattggcagagaaatactgtttatcgacat
tatacaagaaacagcaagcaaatcatttggttttggcagtttgtgaaagagacagacaat
gaagtaagaatgcgactattgcagttcgtcactggaacctgccgtttacctctaggagga
tttgctgagctcatgggaagtaatgggcctcaaaagttttgcattgaaaaagttggcaaa
gacacttggttaccaagaagccatacatgttttaatcgcttggatctaccaccatataag
agttatgaacaactaaaggaaaaacttctttttgcaatagaagagacagagggatttgga
caagaatga

DBGET integrated database retrieval system