KEGG   Homo sapiens (human): 11069Help
Entry
11069             CDS       T01001                                 

Gene name
RAPGEF4, 2, CAMP-GEFII, CGEF2, EPAC, EPAC_2, EPAC2, Nbla00496
Definition
Rap guanine nucleotide exchange factor (GEF) 4
Orthology
K04351  
Rap guanine nucleotide exchange factor 4
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Leukocyte transendothelial migration
Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    11069 (RAPGEF4)
   04024 cAMP signaling pathway
    11069 (RAPGEF4)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    11069 (RAPGEF4)
  Endocrine system
   04911 Insulin secretion
    11069 (RAPGEF4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11069 (RAPGEF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31-q32
AA seq 867 aa AA seqDB search
MLYKKYRQYMAGLLAPPYGVMETGSNNDRIPDKENTPLIEPHVPLRPANTITKVPSEKIL
RAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTPCVHSRTQAVGMWQV
LLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLPTEEEKKECDEELQDTMLLLSQMGP
DAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVL
FNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCH
FLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGT
PEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLCPALVAHYHAQPSQGTEQ
EKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMAFLEEFYVSVSDDARMIAALKEQLP
ELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTI
RVPVATSVKEVISAVADKLGSGEGLIIVKMSSGGEKVVLKPNDVSVFTTLTINGRLFACP
REQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQMTIYDWELFNCVHELELIYHTFGRH
NFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFF
AIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFM
PLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNHQDVR
SYVRQLNVIDNQRTLSQMSHRLEPRRP
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaagaaatatcgacagtatatggcaggacttctggctcctccttatggtgtt
atggaaacgggctctaacaatgacaggattcctgacaaggagaacacacctctcattgaa
cctcacgttcctcttcgtcctgctaacaccattaccaaggtcccttcagagaagatcctc
agagctggaaaaattttacgaaatgccattctctctcgagcacctcacatgataagagat
agaaaataccacctaaagacatacagacaatgctgtgtgggaactgaactggtggactgg
atgatgcagcagacaccatgtgttcactcccggactcaagctgttggcatgtggcaagtc
ctgttagaagatggtgttctcaaccacgtggaccaggagcaccatttccaagacaaatat
ttattctatcgatttctggatgatgagcacgaggatgcccctttgcctactgaggaggag
aagaaggagtgtgatgaggagctccaggacaccatgctgctgctgtcacagatgggcccc
gacgcccacatgaggatgatccttcgcaaaccacctggccagaggactgtggatgaccta
gagattatctatgaggagcttcttcatattaaagccttatcccatctttctaccacagtg
aaacgagagttagcaggtgttctcatttttgagtctcacgccaaaggagggactgtgttg
tttaaccagggggaagaaggtacctcctggtacattattctaaaaggatcagtgaatgta
gtcatttacggcaagggtgtggtctgcaccctgcatgaaggagatgacttcggcaagtta
gcactagtgaatgatgccccacgagctgcctctatcgtcttacgagaagataactgccat
ttcttaagagtagacaaggaggatttcaaccggatcctaagggacgtggaggcgaataca
gtcagacttaaagaacatgaccaagatgtcttggtgctggagaaggtcccagcagggaac
agagcttctaatcaaggaaactcacagcctcagcaaaagtatactgtgatgtcaggaaca
cctgaaaaaattttagagcattttctagaaacaatacgccttgaggcaactttaaatgaa
gcaacagattctgttttaaatgactttattatgatgcactgtgtttttatgccaaatacc
cagctttgcccggcactggtggcccactaccacgcacagccttcacaaggtacagaacag
gagaaaatggattatgccctcaacaataagaggcgagtcatccgcctggttctacagtgg
gctgccatgtatggagacctcctgcaagaggatgacgtgtctatggccttcctggaggag
ttttatgtatctgtatcagatgatgcccggatgattgctgccctcaaggagcaactgcca
gagttggagaagattgtcaagcaaatctcagaagatgcaaaggcaccacaaaagaagcac
aaggttcttttgcaacagttcaatacgggcgatgagagagcccagaagcgccagcctatc
cgcggctctgatgaagttctgtttaaggtctattgcatggaccacacctacacaaccatt
cgggtgccagtggccacttcggtgaaggaagtcatcagtgcagttgccgacaagctgggc
tccggggagggcctgatcatagtcaagatgagttccggaggagaaaaggtggtgctcaaa
cctaatgatgtttcagtatttacgacgctcaccattaatggacgcctgtttgcttgcccg
cgagagcaattcgattcactgactcccttaccagaacaggaaggcccaactgttggaaca
gtgggaacttttgaactgatgagctccaaagatttagcataccagatgacaatttatgat
tgggaactcttcaactgcgtgcatgagctggagctaatctatcacacatttggaaggcat
aattttaaaaagaccacagcaaacttggatttgttcctgaggagatttaatgaaattcag
ttttgggtcgtcactgagatctgcctttgttctcagctcagcaagcgtgttcagctatta
aaaaaatttattaagatagcagcccactgtaaggagtataaaaatctgaattcctttttt
gccatcgtcatgggactaagtaacgttgctgtgagccgcttggcactaacgtgggagaaa
ctgccaagcaagttcaagaagttctatgcggagtttgaaagtttaatggacccttcaagg
aaccacagggcctacaggctgacagtagctaagctggaacctcctctcatccccttcatg
cctttgctcattaaagatatgacatttactcatgaggggaacaagacgttcattgacaat
ctagtaaactttgaaaaaatgcgcatgattgcaaatacggccagaacagtgagatactac
aggagccaacccttcaatcctgatgcagctcaagctaataagaaccatcaggatgtccgg
agttatgtacggcaattaaatgtgattgacaaccagagaactttatcacagatgtcacac
agattagagcctcgtcgaccatag

DBGET integrated database retrieval system