KEGG   Homo sapiens (human): 11072Help
Entry
11072             CDS       T01001                                 

Gene name
DUSP14, MKP-L, MKP6
Definition
dual specificity phosphatase 14 (EC:3.1.3.16 3.1.3.48)
Orthology
K14165  
atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 198 aa AA seqDB search
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGI
VPDVYEKESRHLMPYWGI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagctccagaggtcacagcacgctaccaaggactctcatggcccctcggatgatttcc
gagggagacataggaggcattgctcaaatcacctcctctctattcctgggcagaggcagt
gtggcctccaatcggcacctcctccaggctcgtggcatcacctgcattgttaatgctacc
attgagatccctaatttcaactggccccaatttgagtatgttaaagtgcctctggctgac
atgccgcatgcccccattggactgtactttgacaccgtggctgacaagatccacagtgtg
agcaggaagcacggggccaccttggtgcactgtgctgcaggggtgagccgctcagccacg
ctgtgtatcgcgtacctgatgaaattccacaacgtgtgcctgctggaggcgtacaactgg
gtgaaagcccggcgacctgtcatcaggcccaacgtaggcttctggaggcaactgatagac
tacgagcgccagctctttgggaagtcgacagttaaaatggtacagacaccttatggcata
gttcccgacgtctatgagaaggagtcccgacacctgatgccttactgggggatttag

DBGET integrated database retrieval system