KEGG   Homo sapiens (human): 1108Help
Entry
1108              CDS       T01001                                 

Gene name
CHD4, Mi-2b, Mi2-BETA
Definition
chromodomain helicase DNA binding protein 4 (EC:3.6.4.12)
Orthology
K11643  
chromodomain-helicase-DNA-binding protein 4 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 1912 aa AA seqDB search
MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKP
RDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKL
GPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKA
FSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESM
VTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGG
FGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTKKKKKGEEEVT
AVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPL
PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPE
RQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKN
KDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVE
IQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLD
ATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLV
SAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLL
TGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKA
DVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCN
HPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLD
LLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADT
VIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVR
PGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRH
HYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDER
SEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFT
TQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMS
LIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPA
EDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEK
AEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP
KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAG
IINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLR
RAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEEL
LSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQQVAQQQ
NT seq 5739 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggcctgggctccccgtccccctgctcggcgggcagtgaggaggaggatatg
gatgcacttttgaacaacagcctgcccccaccccacccagaaaatgaagaggacccagaa
gaggatttgtcagaaacagagactccaaagctcaagaagaagaaaaagcctaagaaacct
cgggaccctaaaatccctaagagcaagcgccaaaaaaaggagcgtatgctcttatgccgg
cagctgggggacagctctggggaggggccagagtttgtggaggaggaggaagaggtggct
ctgcgctcagacagtgagggcagcgactatactcctggcaagaagaagaagaagaagctt
ggacctaagaaagagaagaagagcaaatccaagcggaaggaggaggaggaggaggaggat
gatgatgatgattcaaaggagcctaaatcatctgctcagctcctggaagactggggcatg
gaagacattgaccacgtgttctcagaggaggattatcgaaccctcaccaactacaaggcc
ttcagccagtttgtcagacccctcattgctgccaaaaatcccaagattgctgtctccaag
atgatgatggttttgggtgcaaaatggcgggagttcagtaccaataaccccttcaaaggc
agttctggggcatcagtggcagctgcggcagcagcagcggtagctgtggtggagagcatg
gtgacagccactgaggttgcaccaccacctccccctgtggaggtgcctatccgcaaggcc
aagaccaaggagggcaaaggtcccaatgctcggaggaagcccaagggcagccctcgtgta
cctgatgccaagaagcctaaacccaagaaagtagctcccctgaaaatcaagctgggaggt
tttggttccaagcgtaagagatcctcgagtgaggatgatgacttagatgtggaatctgac
ttcgatgatgccagtatcaatagctattctgtttctgatggttccaccagccgtagtagc
cgcagccgcaagaaactccgaaccactaaaaagaaaaagaaaggcgaggaggaggtgact
gctgtggatggttatgagacagaccaccaggactattgcgaggtgtgccagcaaggcggt
gagatcatcctgtgtgatacctgtccccgtgcttaccacatggtctgcctggatcccgac
atggagaaggctcccgagggcaagtggagctgcccacactgcgagaaggaaggcatccag
tgggaagctaaagaggacaattcggagggtgaggagatcctggaagaggttgggggagac
ctcgaagaggaggatgaccaccatatggaattctgtcgggtctgcaaggatggtggggaa
ctgctctgctgtgatacctgtccttcttcctaccacatccactgcctgaatcccccactt
ccagagatccccaacggtgaatggctctgtccccgttgtacgtgtccagctctgaagggc
aaagtgcagaagatcctaatctggaagtggggtcagccaccatctcccacaccagtgcct
cggcctccagatgctgatcccaacacgccctccccaaagcccttggaggggcggccagag
cggcagttctttgtgaaatggcaaggcatgtcttactggcactgctcctgggtttctgaa
ctgcagctggagctgcactgtcaggtgatgttccgaaactatcagcggaagaatgatatg
gatgagccaccttctggggactttggtggtgatgaagagaaaagccgaaagcgaaagaac
aaggaccctaaatttgcagagatggaggaacgcttctatcgctatgggataaaacccgag
tggatgatgatccaccgaatcctcaaccacagtgtggacaagaagggccacgtccactac
ttgatcaagtggcgggacttaccttacgatcaggcttcttgggagagtgaggatgtggag
atccaggattacgacctgttcaagcagagctattggaatcacagggagttaatgaggggt
gaggaaggccgaccaggcaagaagctcaagaaggtgaagcttcggaagttggagaggcct
ccagaaacgccaacagttgatccaacagtgaagtatgagcgacagccagagtacctggat
gctacaggtggaaccctgcacccctatcaaatggagggcctgaattggttgcgcttctcc
tgggctcagggcactgacaccatcttggctgatgagatgggccttgggaaaactgtacag
acagcagtcttcctgtattccctttacaaggagggtcattccaaaggccccttcctagtg
agcgcccctctttctaccatcatcaactgggagcgggagtttgaaatgtgggctccagac
atgtatgtcgtaacctatgtgggtgacaaggacagccgtgccatcatccgagagaatgag
ttctcctttgaagacaatgccattcgtggtggcaagaaggcctcccgcatgaagaaagag
gcatctgtgaaattccatgtgctgctgacatcctatgaattgatcaccattgacatggct
attttgggctctattgattgggcctgcctcatcgtggatgaagcccatcggctgaagaac
aatcagtctaagttcttccgggtattgaatggttactcactccagcacaagctgttgctg
actgggacaccattacaaaacaatctggaagagttgtttcatctgctcaactttctcacc
cccgagaggttccacaatttggaaggttttttggaggagtttgctgacattgccaaggag
gaccagataaaaaaactgcatgacatgctggggccgcacatgttgcggcggctcaaagcc
gatgtgttcaagaacatgccctccaagacagaactaattgtgcgtgtggagctgagccct
atgcagaagaaatactacaagtacatcctcactcgaaattttgaagcactcaatgcccga
ggtggtggcaaccaggtgtctctgctgaatgtggtgatggatcttaagaagtgctgcaac
catccatacctcttccctgtggctgcaatggaagctcctaagatgcctaatggcatgtat
gatggcagtgccctaatcagagcatctgggaaattattgctgctgcagaaaatgctcaag
aaccttaaggagggtgggcatcgtgtactcatcttttcccagatgaccaagatgctagac
ctgctagaggatttcttggaacatgaaggttataaatacgaacgcatcgatggtggaatc
actgggaacatgcggcaagaggccattgaccgcttcaatgcaccgggtgctcagcagttc
tgcttcttgctttccactcgagctgggggccttggaatcaatctggccactgctgacaca
gttattatctatgactctgactggaacccccataatgacattcaggcctttagcagagct
caccggattgggcaaaataaaaaggtaatgatctaccggtttgtgacccgtgcgtcagtg
gaggagcgcatcacgcaggtggcaaagaagaaaatgatgctgacgcatctagtggtgcgg
cctgggctgggctccaagactggatctatgtccaaacaggagcttgatgatatcctcaaa
tttggcactgaggaactattcaaggatgaagccactgatggaggaggagacaacaaagag
ggagaagatagcagtgttatccactacgatgataaggccattgaacggctgctagaccgt
aaccaggatgagactgaagacacagaattgcagggcatgaatgaatatttgagctcattc
aaagtggcccagtatgtggtacgggaagaagaaatgggggaggaagaggaggtagaacgg
gaaatcattaaacaggaagaaagtgtggatcctgactactgggagaaattgctgcggcac
cattatgagcagcagcaagaagatctagcccgaaatctgggcaaaggaaaaagaatccgt
aaacaggtcaactacaatgatggctcccaggaggaccgagattggcaggacgaccagtcc
gacaaccagtccgattactcagtggcttcagaggaaggtgatgaagactttgatgaacgt
tcagaagctccccgtaggcccagtcgtaagggcctgcggaatgataaagataagccattg
cctcctctgttggcccgtgttggtgggaatattgaagtacttggttttaatgctcgtcag
cgaaaagcctttcttaatgcaattatgcgatatggtatgccacctcaggatgcttttact
acccagtggcttgtaagagacctgcgaggcaaatcagagaaagagttcaaggcatatgtc
tctcttttcatgcggcatttatgtgagccgggggcagatggggctgagacctttgctgat
ggtgtcccccgagaaggcctgtctcgccagcatgtccttactagaattggtgttatgtct
ttgattcgcaagaaggttcaggagtttgaacatgttaatgggcgctggagcatgcctgaa
ctggctgaggtggaggaaaacaagaagatgtcccagccagggtcaccctccccaaaaact
cctacaccctccactccaggggacacgcagcccaacactcctgcacctgtcccacctgct
gaagatgggataaaaatagaggaaaatagcctcaaagaagaagagagcatagaaggagaa
aaggaggttaaatctacagcccctgagactgccattgagtgtacacaggcccctgcccct
gcctcagaggatgaaaaggtcgttgttgaaccccctgagggagaggagaaagtggaaaag
gcagaggtgaaggagagaacagaggaacctatggagacagagcccaaaggtgctgctgat
gtagagaaggtggaggaaaagtcagcaatagatctgacccctattgtggtagaagacaaa
gaagagaagaaagaagaagaagagaaaaaagaggtgatgcttcagaatggagagaccccc
aaggacctgaatgatgagaaacagaagaaaaatattaaacaacgtttcatgtttaacatt
gcagatggtggttttactgagttgcactccctttggcagaatgaagagcgggcagccaca
gttaccaagaagacttatgagatctggcatcgacggcatgactactggctgctagccggc
attataaaccatggctatgcccggtggcaagacatccagaatgacccacgctatgccatc
ctcaatgagcctttcaagggtgaaatgaaccgtggcaatttcttagagatcaagaataaa
tttctagctcgaaggtttaagctcttagaacaagctctggtgattgaggaacagctgcgc
cgggctgcttacttgaacatgtcagaagacccttctcacccttccatggccctcaacacc
cgctttgctgaggtggagtgtttggcggaaagtcatcagcacctgtccaaggagtcaatg
gcaggaaacaagccagccaatgcagtcctgcacaaagttctgaaacagctggaagaactg
ctgagtgacatgaaagctgatgtgactcgactcccagctaccattgcccgaattccccca
gttgctgtgaggttacagatgtcagagcgtaacattctcagccgcctggcaaaccgggca
cccgaacctaccccacagcaggtagcccagcagcagtga

DBGET integrated database retrieval system