KEGG   Homo sapiens (human): 1108Help
Entry
1108              CDS       T01001                                 

Gene name
CHD4, CHD-4, Mi-2b, Mi2-BETA
Definition
(RefSeq) chromodomain helicase DNA binding protein 4 (EC:3.6.4.12)
  KO
K11643  
chromodomain-helicase-DNA-binding protein 4 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1108 (CHD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     1108 (CHD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 1912 aa AA seqDB search
MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKP
RDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKL
GPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKA
FSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESM
VTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGG
FGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTKKKKKGEEEVT
AVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPL
PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPE
RQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKN
KDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVE
IQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLD
ATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLV
SAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLL
TGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKA
DVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCN
HPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLD
LLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADT
VIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVR
PGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRH
HYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDER
SEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFT
TQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMS
LIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPA
EDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEK
AEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP
KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAG
IINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLR
RAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEEL
LSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQQVAQQQ
NT seq 5739 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggcctgggctccccgtccccctgctcggcgggcagtgaggaggaggatatg
gatgcacttttgaacaacagcctgcccccaccccacccagaaaatgaagaggacccagaa
gaggatttgtcagaaacagagactccaaagctcaagaagaagaaaaagcctaagaaacct
cgggaccctaaaatccctaagagcaagcgccaaaaaaaggagcgtatgctcttatgccgg
cagctgggggacagctctggggaggggccagagtttgtggaggaggaggaagaggtggct
ctgcgctcagacagtgagggcagcgactatactcctggcaagaagaagaagaagaagctt
ggacctaagaaagagaagaagagcaaatccaagcggaaggaggaggaggaggaggaggat
gatgatgatgattcaaaggagcctaaatcatctgctcagctcctggaagactggggcatg
gaagacattgaccacgtgttctcagaggaggattatcgaaccctcaccaactacaaggcc
ttcagccagtttgtcagacccctcattgctgccaaaaatcccaagattgctgtctccaag
atgatgatggttttgggtgcaaaatggcgggagttcagtaccaataaccccttcaaaggc
agttctggggcatcagtggcagctgcggcagcagcagcggtagctgtggtggagagcatg
gtgacagccactgaggttgcaccaccacctccccctgtggaggtgcctatccgcaaggcc
aagaccaaggagggcaaaggtcccaatgctcggaggaagcccaagggcagccctcgtgta
cctgatgccaagaagcctaaacccaagaaagtagctcccctgaaaatcaagctgggaggt
tttggttccaagcgtaagagatcctcgagtgaggatgatgacttagatgtggaatctgac
ttcgatgatgccagtatcaatagctattctgtttctgatggttccaccagccgtagtagc
cgcagccgcaagaaactccgaaccactaaaaagaaaaagaaaggcgaggaggaggtgact
gctgtggatggttatgagacagaccaccaggactattgcgaggtgtgccagcaaggcggt
gagatcatcctgtgtgatacctgtccccgtgcttaccacatggtctgcctggatcccgac
atggagaaggctcccgagggcaagtggagctgcccacactgcgagaaggaaggcatccag
tgggaagctaaagaggacaattcggagggtgaggagatcctggaagaggttgggggagac
ctcgaagaggaggatgaccaccatatggaattctgtcgggtctgcaaggatggtggggaa
ctgctctgctgtgatacctgtccttcttcctaccacatccactgcctgaatcccccactt
ccagagatccccaacggtgaatggctctgtccccgttgtacgtgtccagctctgaagggc
aaagtgcagaagatcctaatctggaagtggggtcagccaccatctcccacaccagtgcct
cggcctccagatgctgatcccaacacgccctccccaaagcccttggaggggcggccagag
cggcagttctttgtgaaatggcaaggcatgtcttactggcactgctcctgggtttctgaa
ctgcagctggagctgcactgtcaggtgatgttccgaaactatcagcggaagaatgatatg
gatgagccaccttctggggactttggtggtgatgaagagaaaagccgaaagcgaaagaac
aaggaccctaaatttgcagagatggaggaacgcttctatcgctatgggataaaacccgag
tggatgatgatccaccgaatcctcaaccacagtgtggacaagaagggccacgtccactac
ttgatcaagtggcgggacttaccttacgatcaggcttcttgggagagtgaggatgtggag
atccaggattacgacctgttcaagcagagctattggaatcacagggagttaatgaggggt
gaggaaggccgaccaggcaagaagctcaagaaggtgaagcttcggaagttggagaggcct
ccagaaacgccaacagttgatccaacagtgaagtatgagcgacagccagagtacctggat
gctacaggtggaaccctgcacccctatcaaatggagggcctgaattggttgcgcttctcc
tgggctcagggcactgacaccatcttggctgatgagatgggccttgggaaaactgtacag
acagcagtcttcctgtattccctttacaaggagggtcattccaaaggccccttcctagtg
agcgcccctctttctaccatcatcaactgggagcgggagtttgaaatgtgggctccagac
atgtatgtcgtaacctatgtgggtgacaaggacagccgtgccatcatccgagagaatgag
ttctcctttgaagacaatgccattcgtggtggcaagaaggcctcccgcatgaagaaagag
gcatctgtgaaattccatgtgctgctgacatcctatgaattgatcaccattgacatggct
attttgggctctattgattgggcctgcctcatcgtggatgaagcccatcggctgaagaac
aatcagtctaagttcttccgggtattgaatggttactcactccagcacaagctgttgctg
actgggacaccattacaaaacaatctggaagagttgtttcatctgctcaactttctcacc
cccgagaggttccacaatttggaaggttttttggaggagtttgctgacattgccaaggag
gaccagataaaaaaactgcatgacatgctggggccgcacatgttgcggcggctcaaagcc
gatgtgttcaagaacatgccctccaagacagaactaattgtgcgtgtggagctgagccct
atgcagaagaaatactacaagtacatcctcactcgaaattttgaagcactcaatgcccga
ggtggtggcaaccaggtgtctctgctgaatgtggtgatggatcttaagaagtgctgcaac
catccatacctcttccctgtggctgcaatggaagctcctaagatgcctaatggcatgtat
gatggcagtgccctaatcagagcatctgggaaattattgctgctgcagaaaatgctcaag
aaccttaaggagggtgggcatcgtgtactcatcttttcccagatgaccaagatgctagac
ctgctagaggatttcttggaacatgaaggttataaatacgaacgcatcgatggtggaatc
actgggaacatgcggcaagaggccattgaccgcttcaatgcaccgggtgctcagcagttc
tgcttcttgctttccactcgagctgggggccttggaatcaatctggccactgctgacaca
gttattatctatgactctgactggaacccccataatgacattcaggcctttagcagagct
caccggattgggcaaaataaaaaggtaatgatctaccggtttgtgacccgtgcgtcagtg
gaggagcgcatcacgcaggtggcaaagaagaaaatgatgctgacgcatctagtggtgcgg
cctgggctgggctccaagactggatctatgtccaaacaggagcttgatgatatcctcaaa
tttggcactgaggaactattcaaggatgaagccactgatggaggaggagacaacaaagag
ggagaagatagcagtgttatccactacgatgataaggccattgaacggctgctagaccgt
aaccaggatgagactgaagacacagaattgcagggcatgaatgaatatttgagctcattc
aaagtggcccagtatgtggtacgggaagaagaaatgggggaggaagaggaggtagaacgg
gaaatcattaaacaggaagaaagtgtggatcctgactactgggagaaattgctgcggcac
cattatgagcagcagcaagaagatctagcccgaaatctgggcaaaggaaaaagaatccgt
aaacaggtcaactacaatgatggctcccaggaggaccgagattggcaggacgaccagtcc
gacaaccagtccgattactcagtggcttcagaggaaggtgatgaagactttgatgaacgt
tcagaagctccccgtaggcccagtcgtaagggcctgcggaatgataaagataagccattg
cctcctctgttggcccgtgttggtgggaatattgaagtacttggttttaatgctcgtcag
cgaaaagcctttcttaatgcaattatgcgatatggtatgccacctcaggatgcttttact
acccagtggcttgtaagagacctgcgaggcaaatcagagaaagagttcaaggcatatgtc
tctcttttcatgcggcatttatgtgagccgggggcagatggggctgagacctttgctgat
ggtgtcccccgagaaggcctgtctcgccagcatgtccttactagaattggtgttatgtct
ttgattcgcaagaaggttcaggagtttgaacatgttaatgggcgctggagcatgcctgaa
ctggctgaggtggaggaaaacaagaagatgtcccagccagggtcaccctccccaaaaact
cctacaccctccactccaggggacacgcagcccaacactcctgcacctgtcccacctgct
gaagatgggataaaaatagaggaaaatagcctcaaagaagaagagagcatagaaggagaa
aaggaggttaaatctacagcccctgagactgccattgagtgtacacaggcccctgcccct
gcctcagaggatgaaaaggtcgttgttgaaccccctgagggagaggagaaagtggaaaag
gcagaggtgaaggagagaacagaggaacctatggagacagagcccaaaggtgctgctgat
gtagagaaggtggaggaaaagtcagcaatagatctgacccctattgtggtagaagacaaa
gaagagaagaaagaagaagaagagaaaaaagaggtgatgcttcagaatggagagaccccc
aaggacctgaatgatgagaaacagaagaaaaatattaaacaacgtttcatgtttaacatt
gcagatggtggttttactgagttgcactccctttggcagaatgaagagcgggcagccaca
gttaccaagaagacttatgagatctggcatcgacggcatgactactggctgctagccggc
attataaaccatggctatgcccggtggcaagacatccagaatgacccacgctatgccatc
ctcaatgagcctttcaagggtgaaatgaaccgtggcaatttcttagagatcaagaataaa
tttctagctcgaaggtttaagctcttagaacaagctctggtgattgaggaacagctgcgc
cgggctgcttacttgaacatgtcagaagacccttctcacccttccatggccctcaacacc
cgctttgctgaggtggagtgtttggcggaaagtcatcagcacctgtccaaggagtcaatg
gcaggaaacaagccagccaatgcagtcctgcacaaagttctgaaacagctggaagaactg
ctgagtgacatgaaagctgatgtgactcgactcccagctaccattgcccgaattccccca
gttgctgtgaggttacagatgtcagagcgtaacattctcagccgcctggcaaaccgggca
cccgaacctaccccacagcaggtagcccagcagcagtga

DBGET integrated database retrieval system