KEGG   Homo sapiens (human): 11092Help
Entry
11092             CDS       T01001                                 

Gene name
SPACA9, C9orf9, Mast
Definition
(RefSeq) sperm acrosome associated 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96E40(Tdark)
UniProt: 
Position
9q34.13
AA seq 222 aa AA seqDB search
MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSS
TDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHD
VVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAA
RPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtgaaagaatcccttcgcagcatcgagcagaagtacaagctcttccagcag
cagcagctcaccttcaccgccgctctggagcactgcagggagaacgcccacgacaagatc
cggcccatctccagcattggacaggtgcagagctacatggaacactactgcaacagctcc
acagaccggcgggttctgctcatgttcctggacatctgttcagagctgaataagctctgc
cagcactttgaggccgtgcactctggcaccccagtcaccaacaacctcctggagaaatgc
aaaaccctcgttagccaaagcaacgacttaagcagcctcagagcaaaataccctcatgat
gtggtgaaccacctcagctgtgacgaggcccggaaccactacggcggcgtggtcagcctc
atccccctcatcctagacttaatgaaagaatggatcgcccactccgagaagttgccgcgc
aaggtgctgcagcacgtgagtgagccccaggcgcaccaggagagcaccaggggagccgct
cgtcctgcccaggccatagggacccagcccagggccactaaacacaagtgtagacagctc
acaaaagccagcctcaaacccaggggatgttcaaaaccaccctggaggcctcctggtggg
aaattgtaa

DBGET integrated database retrieval system