KEGG   Homo sapiens (human): 11093Help
Entry
11093             CDS       T01001                                 

Gene name
ADAMTS13, ADAM-TS13, ADAMTS-13, C9orf8, VWFCP, vWF-CP
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  
a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
hsa  Homo sapiens (human)
Disease
H00225  
Thrombotic thrombocytopenic purpura
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     11093 (ADAMTS13)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   11093 (ADAMTS13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34
AA seq 1427 aa AA seqDB search
MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP
PSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL
GAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR
FDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGS
GCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHPPDAQ
PGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTEC
GVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPRSPCSRSCGGGVVTRRRQCNNPRPAFGG
RACVGADLQAEMCNTQACEKTQLEFMSQQCARTDGQPLRSSPGGASFYHWGAAVPHSQGD
ALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQ
VWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIG
GRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPRLEEIRIWGPLQEDADIQVYRR
YGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVE
TVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVRCVEAQGSLLKTL
PPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGAGLALENETCVPGADGLEA
PVTEGPGSVDEKLPAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRTGAQAAHVWTPA
AGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWQYKLA
ACSVSCGRGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMS
LGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYRWHVGT
WMECSVSCGDGIQRRRDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSLVP
HEEAAAPGRTTATPAGASLEWSQARGLLFSPAPQPRRLLPGPQENSVQSSACGRQHLEPT
GTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKLLDM
TFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATS
NAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWE
SESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagcgtcacccccgggcaagatgccctcccctctgtgtggccggaatccttgcc
tgtggctttctcctgggctgctggggaccctcccatttccagcagagttgtcttcaggct
ttggagccacaggccgtgtcttcttacttgagccctggtgctcccttaaaaggccgccct
ccttcccctggcttccagaggcagaggcagaggcagaggcgggctgcaggcggcatccta
cacctggagctgctggtggccgtgggccccgatgtcttccaggctcaccaggaggacaca
gagcgctatgtgctcaccaacctcaacatcggggcagaactgcttcgggacccgtccctg
ggggctcagtttcgggtgcacctggtgaagatggtcattctgacagagcctgagggtgct
ccaaatatcacagccaacctcacctcgtccctgctgagcgtctgtgggtggagccagacc
atcaaccctgaggacgacacggatcctggccatgctgacctggtcctctatatcactagg
tttgacctggagttgcctgatggtaaccggcaggtgcggggcgtcacccagctgggcggt
gcctgctccccaacctggagctgcctcattaccgaggacactggcttcgacctgggagtc
accattgcccatgagattgggcacagcttcggcctggagcacgacggcgcgcccggcagc
ggctgcggccccagcggacacgtgatggcttcggacggcgccgcgccccgcgccggcctc
gcctggtccccctgcagccgccggcagctgctgagcctgctcagcgcaggacgggcgcgc
tgcgtgtgggacccgccgcggcctcaacccgggtccgcggggcacccgccggatgcgcag
cctggcctctactacagcgccaacgagcagtgccgcgtggccttcggccccaaggctgtc
gcctgcaccttcgccagggagcacctggatatgtgccaggccctctcctgccacacagac
ccgctggaccaaagcagctgcagccgcctcctcgttcctctcctggatgggacagaatgt
ggcgtggagaagtggtgctccaagggtcgctgccgctccctggtggagctgacccccata
gcagcagtgcatgggcgctggtctagctggggtccccgaagtccttgctcccgctcctgc
ggaggaggtgtggtcaccaggaggcggcagtgcaacaaccccagacctgcctttgggggg
cgtgcatgtgttggtgctgacctccaggccgagatgtgcaacactcaggcctgcgagaag
acccagctggagttcatgtcgcaacagtgcgccaggaccgacggccagccgctgcgctcc
tcccctggcggcgcctccttctaccactggggtgctgctgtaccacacagccaaggggat
gctctgtgcagacacatgtgccgggccattggcgagagcttcatcatgaagcgtggagac
agcttcctcgatgggacccggtgtatgccaagtggcccccgggaggacgggaccctgagc
ctgtgtgtgtcgggcagctgcaggacatttggctgtgatggtaggatggactcccagcag
gtatgggacaggtgccaggtgtgtggtggggacaacagcacgtgcagcccacggaagggc
tctttcacagctggcagagcgagagaatatgtcacgtttctgacagttacccccaacctg
accagtgtctacattgccaaccacaggcctctcttcacacacttggcggtgaggatcgga
gggcgctatgtcgtggctgggaagatgagcatctcccctaacaccacctacccctccctc
ctggaggatggtcgtgtcgagtacagagtggccctcaccgaggaccggctgccccgcctg
gaggagatccgcatctggggacccctccaggaagatgctgacatccaggtttacaggcgg
tatggcgaggagtatggcaacctcacccgcccagacatcaccttcacctacttccagcct
aagccacggcaggcctgggtgtgggccgctgtgcgtgggccctgctcggtgagctgtggg
gcagggctgcgctgggtaaactacagctgcctggaccaggccaggaaggagttggtggag
actgtccagtgccaagggagccagcagccaccagcgtggccagaggcctgcgtgctcgaa
ccctgccctccctactgggcggtgggagacttcggcccatgcagcgcctcctgtgggggt
ggcctgcgggagcggccagtgcgctgcgtggaggcccagggcagcctcctgaagacattg
cccccagcccggtgcagagcaggggcccagcagccagctgtggcgctggaaacctgcaac
ccccagccctgccctgccaggtgggaggtgtcagagcccagctcatgcacatcagctggt
ggagcaggcctggccttggagaacgagacctgtgtgccaggggcagatggcctggaggct
ccagtgactgaggggcctggctccgtagatgagaagctgcctgcccctgagccctgtgtc
gggatgtcatgtcctccaggctggggccatctggatgccacctctgcaggggagaaggct
ccctccccatggggcagcatcaggacgggggctcaagctgcacacgtgtggacccctgcg
gcagggtcgtgctccgtctcctgcgggcgaggtctgatggagctgcgtttcctgtgcatg
gactctgccctcagggtgcctgtccaggaagagctgtgtggcctggcaagcaagcctggg
agccggcgggaggtctgccaggctgtcccgtgccctgctcggtggcagtacaagctggcg
gcctgcagcgtgagctgtgggagaggggtcgtgcggaggatcctgtattgtgcccgggcc
catggggaggacgatggtgaggagatcctgttggacacccagtgccaggggctgcctcgc
ccggaaccccaggaggcctgcagcctggagccctgcccacctaggtggaaagtcatgtcc
cttggcccatgttcggccagctgtggccttggcactgctagacgctcggtggcctgtgtg
cagctcgaccaaggccaggacgtggaggtggacgaggcggcctgtgcggcgctggtgcgg
cccgaggccagtgtcccctgtctcattgccgactgcacctaccgctggcatgttggcacc
tggatggagtgctctgtttcctgtggggatggcatccagcgccggcgtgacacctgcctc
ggaccccaggcccaggcgcctgtgccagctgatttctgccagcacttgcccaagccggtg
actgtgcgtggctgctgggctgggccctgtgtgggacagggtacgcccagcctggtgccc
cacgaagaagccgctgctccaggacggaccacagccacccctgctggtgcctccctggag
tggtcccaggcccggggcctgctcttctccccggctccccagcctcggcggctcctgccc
gggccccaggaaaactcagtgcagtccagtgcctgtggcaggcagcaccttgagccaaca
ggaaccattgacatgcgaggcccagggcaggcagactgtgcagtggccattgggcggccc
ctcggggaggtggtgaccctccgcgtccttgagagttctctcaactgcagtgcgggggac
atgttgctgctttggggccggctcacctggaggaagatgtgcaggaagctgttggacatg
actttcagctccaagaccaacacgctggtggtgaggcagcgctgcgggcggccaggaggt
ggggtgctgctgcggtatgggagccagcttgctcctgaaaccttctacagagaatgtgac
atgcagctctttgggccctggggtgaaatcgtgagcccctcgctgagtccagccacgagt
aatgcagggggctgccggctcttcattaatgtggctccgcacgcacggattgccatccat
gccctggccaccaacatgggcgctgggaccgagggagccaatgccagctacatcttgatc
cgggacacccacagcttgaggaccacagcgttccatgggcagcaggtgctctactgggag
tcagagagcagccaggctgagatggagttcagcgagggcttcctgaaggctcaggccagc
ctgcggggccagtactggaccctccaatcatgggtaccggagatgcaggaccctcagtcc
tggaagggaaaggaaggaacctga

DBGET integrated database retrieval system