KEGG   Homo sapiens (human): 11097Help
Entry
11097             CDS       T01001                                 

Gene name
NUPL2, CG1, NLP-1, NLP_1, hCG1
Definition
nucleoporin like 2
Orthology
K14321  
nucleoporin-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    11097 (NUPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15
AA seq 423 aa AA seqDB search
MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKEGFGLSENPFASLSPDEQKDEKKLLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQR
LINQWRNRVNELKSLNISTKVALLSDVKDGVNQAAPAFGFGSSQAATFMSPGFPVNNSSS
DNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSGISTSAPAFGFGKPEVTSAAS
FSFKSPAASSFGSPGFSGLPASLATGPVRAPVAPAFGGGSSVAGFGSPGSHSHTAFSKPS
SDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL
LNV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccatttgtcaattcttccttcaaggccggtgccgctttggagatcggtgctggaac
gaacatcccggtgctaggggtgcaggaggaggacggcagcaaccgcagcagcagccttca
ggtaataatagacgtggatggaatacaactagccagagatattccaatgtcatccagcca
tccagtttctccaaatccacaccatgggggggcagcagagatcaagaaaagccatatttc
agttcttttgattctggagcttcaactaacaggaaggaaggctttggattgtctgagaac
ccatttgcttcacttagtcctgatgagcagaaagatgaaaagaaacttctggaaggaatt
gtaaaagatatggaggtttgggaatcatcagggcagtggatgttttctgtttattcacca
gtgaaaaagaaacctaatatttcaggttttacagacatttcaccagaggaattgaggctt
gaataccataacttcttaaccagcaataacttacagagttatctaaattctgtccaacgt
ttaataaatcaatggaggaacagggtaaatgaactgaaaagtctaaatatatcaactaaa
gtagctttgctctctgatgtaaaggatggagtaaatcaagcagcacctgcatttggattt
ggcagcagtcaagcagcaacatttatgtcgccaggctttccagtcaataacagcagcagt
gataatgctcagaactttagttttaaaacaaactctggatttgctgctgcctcttctgga
agccctgctggttttgggagttccccagcatttggagctgcagcctctaccagttcaggt
atctctacttctgctccagcttttggatttgggaagcctgaagtcacatcggctgcatca
ttttcattcaaaagccctgcagcttccagttttggatcacctggattttcaggacttcca
gcttccttggcaacaggtcctgtcagagctccagtggccccagcctttggaggtggcagt
tctgtggctggttttggtagtccgggctcacattctcacactgctttttctaagccatcc
agtgacacttttggaaatagcagcatatccacttctctgtcagcctcaagcagcatcatt
gcaacagataatgtgttattcacacccagagataaactaacagtagaagaactggaacaa
tttcaatccaagaaatttactctgggaaaaattccattaaagcctccacctctggaactt
ctaaatgtttaa

DBGET integrated database retrieval system