KEGG   Homo sapiens (human): 11100Help
Entry
11100             CDS       T01001                                 

Gene name
HNRNPUL1, E1B-AP5, E1BAP5, HNRPUL1
Definition
heterogeneous nuclear ribonucleoprotein U-like 1
Orthology
K15047  
heterogeneous nuclear ribonucleoprotein U-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05164 Influenza A
    11100 (HNRNPUL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 856 aa AA seqDB search
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHI
NEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQEN
ESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRG
RGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFA
YLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPF
SYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQK
EALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVL
IQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKD
RTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRK
AGPPPEKRFDNRGGGGFRGRGGGGGFQRYENRGPPGGNRGGFQNRGGGSGGGGNYRGGFN
RSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA
RNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPP
PPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYSGNTQGGTSTQ
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcgccgtctgaaggtgaacgaacttcgcgaggagctgcagcgccgcggcctg
gacactcgaggcctcaaggccgagcttgctgagcggctgcaggcggcgttggaggccgag
gagcctgacgacgagcgggagctcgacgccgacgacgaaccggggcgacccgggcacatc
aacgaggaggtcgagaccgaggggggctccgagctggaggggaccgcgcagccaccgccg
cccgggctgcagccgcacgcggagcccggcggctactcggggccggacggacattatgcc
atggacaatattaccaggcagaaccaattctacgatacccaagtcatcaaacaagaaaac
gagtcaggctacgagaggagaccactggaaatggagcagcagcaggcctatcgtccagaa
atgaagacagagatgaagcaaggagcacccaccagcttcctcccgcctgaagcttctcaa
ctcaagccagacaggcagcaattccagagtcgaaagaggccttatgaagaaaaccgggga
cgggggtactttgagcaccgagaggataggaggggccgctctcctcagcctcctgctgaa
gaggatgaagatgactttgatgatacccttgttgctattgacacctataactgcgacctc
cacttcaaggtggcccgagatcggagtagtggctatccgctcacaattgagggctttgca
tacctgtggtcaggagcccgtgccagctatggggtcagaaggggccgtgtatgcttcgag
atgaagatcaatgaggaaatctccgtgaagcaccttccgtctacagagcctgacccccac
gtggtccgtatcggctggtccctggactcctgcagcacccagctaggcgaagagcctttc
tcctatggctatggaggcactgggaagaagtccaccaatagccggtttgaaaactacgga
gacaagtttgcagagaacgatgtgattggctgctttgcggattttgaatgtggaaatgac
gtggaactgtcttttaccaagaatggaaagtggatgggcattgctttccgaatccagaag
gaagccttggggggtcaggccctctatcctcatgtcctggtgaagaattgcgcagtggag
ttcaacttcggacagagagcagagccctactgttctgtcctcccggggtttaccttcatc
cagcaccttccccttagtgagcgtatccggggcaccgttggaccaaagagcaaggcagaa
tgtgagattctgatgatggtgggcctgcctgctgctggcaagaccacatgggccatcaaa
catgcagcctccaacccttccaagaagtacaacatcctgggtaccaatgccatcatggat
aagatgcgggtgatgggcctacgccggcagcggaactatgctggccgctgggatgtcctg
atccagcaggccacccagtgcctcaaccgcctcatccagattgctgcccgcaagaaacgc
aactatatcctagatcagacaaatgtttatgggtcagcccagagacgaaaaatgagacca
tttgaaggcttccagcgcaaagctattgtaatttgtcccactgacgaggacctaaaagac
cgaacaataaagcgaaccgacgaggaagggaaggatgtcccagatcatgcggtcttagaa
atgaaagccaacttcacgttgccagatgttggggacttcctggatgaggttctgttcatt
gagctgcagcgggaggaagcggacaagctagtgaggcagtacaacgaggaaggccgcaag
gctgggccaccccctgaaaagcgctttgacaaccgaggtggtggtggcttccggggccgc
gggggtggtggtggcttccagcgctatgaaaaccgaggaccccctggaggcaaccgtggc
ggcttccagaaccgagggggaggcagcggtggaggaggcaactaccgaggaggtttcaac
cgcagcggaggtggtggctatagccagaaccgctggggtaacaacaaccgggataacaac
aactccaacaacagaggcagctacaaccgggctccccagcaacagccgccaccacagcag
cctccgccaccacagccaccaccccagcagccaccgccaccacccagctacagccctgct
cggaaccccccaggggccagcacctacaataagaacagcaacatccctggctcaagcgcc
aataccagcacccccaccgtcagcagctacagccctccacagccgagttacagccagcca
ccctacaaccagggaggttacagccagggctacacagccccaccgcctccacctccacca
ccacctgcctacaactatgggagctacggcggttacaacccggccccctataccccaccg
ccaccccccactgcacagacctaccctcagcccagctataaccagtatcagcagtatgcc
cagcagtggaaccagtactatcagaaccagggccagtggccgccatactacgggaactac
gactacgggagctactccgggaacacacagggtggcacaagtacacagtag

DBGET integrated database retrieval system