KEGG   Homo sapiens (human): 11104Help
Entry
11104             CDS       T01001                                 

Gene name
KATNA1
Definition
(RefSeq) katanin catalytic subunit A1 (EC:3.6.4.3)
  KO
K07767  
katanin p60 ATPase-containing subunit A1 [EC:3.6.4.3]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.3  microtubule-severing ATPase
     11104 (KATNA1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     11104 (KATNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.1
AA seq 491 aa AA seqDB search
MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
YEKWIFEFGSC
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcttatgattagtgagaatgtaaaattggctcgtgaatatgcattgctggga
aactatgactctgcgatggtctattatcagggagttcttgaccaaatgaacaagtatctg
tactcagtcaaagatacatacctccagcagaaatggcaacaggtttggcaggaaataaat
gtggaagctaaacatgttaaagatatcatgaaaacactagagagctttaaactggacagc
actcccttgaaagcggcacagcatgaccttccagcttctgagggagaagtctggtccatg
cctgtacctgttgaacgaagaccctcaccaggacctagaaaacgccaatcttctcagtac
agtgaccctaaatcacatggtaatcgtccaagtacaactgtcagagttcaccgttcatct
gcacagaatgttcacaatgacagagggaaagctgttcgttgtcgtgaaaagaaagaacag
aataaaggaagagaggaaaagaacaaatcacctgctgcagtaacagaaccagagacaaat
aaatttgatagtaccggatatgataaagacttagtagaagctttggaaagagatataatt
tcccagaatcccaatgttcgatgggatgatatcgctgatttagtagaagctaaaaagttg
cttaaggaagccgtagtgttaccaatgtggatgcccgaattctttaagggcattaggaga
ccatggaaaggagtactgatggtcggcccacctggcacggggaagacgctccttgctaaa
gcagtagctacagaatgcaagacaacattcttcaatgtctcttcatcaactttgacttcc
aaatacagaggagaatctgagaagcttgttcgtcttctgtttgaaatggctcgattttat
tctccagccaccatatttattgatgagatagactccatctgtagtcgccgagggacttct
gaagaacatgaagcaagcagaagggtgaaagcggagctgctggttcagatggatggtgtt
ggaggtacttctgaaaatgatgacccttccaaaatggttatggttctggcagctactaat
tttccctgggatatagatgaggctttaagacgacgccttgagaaacgaatctatattcct
ttgccgtcagcaaaaggcagggaggagctattacgaataagtctacgtgagttggaattg
gctgatgatgttgaccttgcaagtatagcagaaaacatggaaggttattcaggtgcggac
attaccaacgtgtgcagggatgcgtccttgatggcaatgagaaggcgcattgaaggtttg
actccagaggaaatccgaaatctttccaaagaagaaatgcacatgcctacaactatggag
gatttcgagatggctttaaaaaaggtttctaagtcagtgtctgctgcagacattgaaaga
tacgagaaatggatatttgagtttggatcatgctaa

DBGET integrated database retrieval system