KEGG   Homo sapiens (human): 11124Help
Entry
11124             CDS       T01001                                 

Gene name
FAF1, CGI-03, HFAF1s, UBXD12, UBXN3A, hFAF1
Definition
(RefSeq) Fas associated factor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p33
AA seq 650 aa AA seqDB search
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGET
IPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTC
TVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAA
FQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLE
QIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacatggaccgggagatgatcctggcggattttcaggcatgtactggcatt
gaaaacattgacgaagctattacattgcttgaacaaaataattgggacttagtggcagct
atcaatggtgtaataccacaggaaaatggcattctacaaagtgaatatggaggtgagacc
ataccaggacctgcatttaatccagcaagtcatccagcttcagctcctacttcctcttct
tcttcagcgtttcgacctgtaatgccatccaggcagattgtagaaaggcaacctcggatg
ctggacttcagggttgaatacagagacagaaatgttgatgtggtacttgaagacacctgt
actgttggagagattaaacagattctagaaaatgaacttcagatacctgtgtccaaaatg
ctgttaaaaggctggaagacgggagatgtggaagacagtacggtcctaaaatctctacac
ttgccaaaaaacaacagtctttatgtccttacaccagatttgccaccaccttcatcatct
agtcatgctggtgccctgcaggagtcattaaatcaaaacttcatgctgatcatcacccac
cgagaagtccagcgggagtacaacctgaacttctcaggaagcagtactattcaagaggta
aagagaaatgtgtatgaccttacaagtatccccgttcgccaccaattatgggagggctgg
ccaacttctgctacagacgactcaatgtgtcttgctgaatcagggctctcttatccctgc
catcgacttacagtgggaagaagatcttcacctgcacagacccgggaacagtcggaagaa
caaatcaccgatgttcatatggttagtgatagcgatggagatgactttgaagatgctaca
gaatttggggtggatgatggagaagtatttggcatggcgtcatctgccttgagaaaatct
ccaatgatgccagaaaacgcagaaaatgaaggagatgccttattacaatttacagcagag
ttttcttcaagatatggtgattgccatcctgtattttttattggctcattagaagctgct
tttcaagaggccttctatgtgaaagcccgagatagaaagcttcttgctatctacctccac
catgatgaaagtgtgttaaccaacgtgttctgctcacaaatgctttgtgctgaatccatt
gtttcttatctgagtcaaaattttataacctgggcttgggatctgacaaaggactccaac
agagcaagatttctcactatgtgcaatagacactttggcagtgttgtggcacaaaccatt
cggactcaaaaaacggatcagtttccgcttttcctgattattatgggaaagcgatcatct
aatgaagtgttgaatgtgatacaagggaacacaacagtagatgagttaatgatgagactc
atggctgcaatggagatcttcacagcccaacaacaggaagatataaaggacgaggatgaa
cgtgaagccagagaaaatgtgaagagagagcaagatgaggcctatcgcctttcacttgag
gctgacagagcaaagagggaagctcacgagagagagatggcagaacagtttcgtttggag
cagattcgcaaagaacaagaagaggaacgtgaggccatccggctgtccttagagcaagcc
ctgcctcctgagccaaaggaagaaaatgctgagcctgtgagcaaactgcggatccggacc
cccagtggcgagttcttggagcggcgtttcctggccagcaacaagctccagattgtcttt
gattttgtagcttccaaaggatttccatgggatgagtacaagttactgagcacctttcct
aggagagacgtaactcaactggacccaaataaatcattattggaggtaaagttgttccct
caagaaacccttttccttgaagcaaaagagtaa

DBGET integrated database retrieval system