KEGG   Homo sapiens (human): 11124Help
Entry
11124             CDS       T01001                                 

Gene name
FAF1, CGI-03, HFAF1s, UBXD12, UBXN3A, hFAF1
Definition
(RefSeq) Fas associated factor 1
  KO
K20703  FAS-associated factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    11124 (FAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UBX UBA_4 ubiquitin AAA_23 Borrelia_P83
Motif
Other DBs
NCBI-GeneID: 11124
NCBI-ProteinID: NP_008982
OMIM: 604460
HGNC: 3578
Ensembl: ENSG00000185104
Vega: OTTHUMG00000007930
Pharos: Q9UNN5(Tbio)
UniProt: Q9UNN5
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 650 aa AA seqDB search
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGET
IPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTC
TVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAA
FQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLE
QIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacatggaccgggagatgatcctggcggattttcaggcatgtactggcatt
gaaaacattgacgaagctattacattgcttgaacaaaataattgggacttagtggcagct
atcaatggtgtaataccacaggaaaatggcattctacaaagtgaatatggaggtgagacc
ataccaggacctgcatttaatccagcaagtcatccagcttcagctcctacttcctcttct
tcttcagcgtttcgacctgtaatgccatccaggcagattgtagaaaggcaacctcggatg
ctggacttcagggttgaatacagagacagaaatgttgatgtggtacttgaagacacctgt
actgttggagagattaaacagattctagaaaatgaacttcagatacctgtgtccaaaatg
ctgttaaaaggctggaagacgggagatgtggaagacagtacggtcctaaaatctctacac
ttgccaaaaaacaacagtctttatgtccttacaccagatttgccaccaccttcatcatct
agtcatgctggtgccctgcaggagtcattaaatcaaaacttcatgctgatcatcacccac
cgagaagtccagcgggagtacaacctgaacttctcaggaagcagtactattcaagaggta
aagagaaatgtgtatgaccttacaagtatccccgttcgccaccaattatgggagggctgg
ccaacttctgctacagacgactcaatgtgtcttgctgaatcagggctctcttatccctgc
catcgacttacagtgggaagaagatcttcacctgcacagacccgggaacagtcggaagaa
caaatcaccgatgttcatatggttagtgatagcgatggagatgactttgaagatgctaca
gaatttggggtggatgatggagaagtatttggcatggcgtcatctgccttgagaaaatct
ccaatgatgccagaaaacgcagaaaatgaaggagatgccttattacaatttacagcagag
ttttcttcaagatatggtgattgccatcctgtattttttattggctcattagaagctgct
tttcaagaggccttctatgtgaaagcccgagatagaaagcttcttgctatctacctccac
catgatgaaagtgtgttaaccaacgtgttctgctcacaaatgctttgtgctgaatccatt
gtttcttatctgagtcaaaattttataacctgggcttgggatctgacaaaggactccaac
agagcaagatttctcactatgtgcaatagacactttggcagtgttgtggcacaaaccatt
cggactcaaaaaacggatcagtttccgcttttcctgattattatgggaaagcgatcatct
aatgaagtgttgaatgtgatacaagggaacacaacagtagatgagttaatgatgagactc
atggctgcaatggagatcttcacagcccaacaacaggaagatataaaggacgaggatgaa
cgtgaagccagagaaaatgtgaagagagagcaagatgaggcctatcgcctttcacttgag
gctgacagagcaaagagggaagctcacgagagagagatggcagaacagtttcgtttggag
cagattcgcaaagaacaagaagaggaacgtgaggccatccggctgtccttagagcaagcc
ctgcctcctgagccaaaggaagaaaatgctgagcctgtgagcaaactgcggatccggacc
cccagtggcgagttcttggagcggcgtttcctggccagcaacaagctccagattgtcttt
gattttgtagcttccaaaggatttccatgggatgagtacaagttactgagcacctttcct
aggagagacgtaactcaactggacccaaataaatcattattggaggtaaagttgttccct
caagaaacccttttccttgaagcaaaagagtaa

DBGET integrated database retrieval system