KEGG   Homo sapiens (human): 11132Help
Entry
11132             CDS       T01001                                 

Gene name
CAPN10, CANP10, NIDDM1
Definition
(RefSeq) calpain 10
  KO
K08579  
calpain-10 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Disease
H00409  
Type II diabetes mellitus
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     11132 (CAPN10)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   11132 (CAPN10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.3
AA seq 672 aa AA seqDB search
MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPDDP
REGQVKQGLLGDCWFLCACAALQKSRHLLDQVIPPGQPSWADQEYRGSFTCRIWQFGRWV
EVTTDDRLPCLAGRLCFSRCQREDVFWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGG
LAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAF
IVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEGWSQVDAAVASELLSQLQEGE
FWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAWVKGQSAGGCRNNSG
FPSNPKFWLRVSEPSEVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAV
GLHLWKVEKRRVNLPRVLSMPPVAGTACHAYDREVHLRCELSPGYYLAVPSTFLKDAPGE
FLLRVFSTGRVSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRVGQTAGGSRNFASYPT
NPCFPFSVPEGPGPRCVRITLHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPL
LSCVPHRYAQEVSRLCLLPAGTYKVVPSTYLPDTEGAFTVTIATRIDRPSIHSQEMLGQF
LQEVSVMAVMKT
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgggccggggcgcgacgccggcgagggagctgttccgggacgccgccttcccc
gccgcggactcctcgctcttctgcgacttgtctacgccgctggcccagttccgcgaggac
atcacgtggaggcggccccaggagatttgtgccacaccccggctgtttccagatgaccca
cgggaagggcaggtgaagcaggggctgctgggggattgctggttcctgtgtgcctgcgcc
gcgctgcagaagagcaggcacctcctggaccaggtcattcctccgggacagccgagctgg
gccgaccaggagtaccggggctccttcacctgtcgcatttggcagtttggacgctgggtg
gaggtgaccacagatgaccgcctgccgtgccttgcagggagactctgtttctcccgctgc
cagagggaggatgtgttctggctccccttactggaaaaggtctacgccaaggtccatggg
tcctacgagcacctgtgggccgggcaggtggcggatgccctggtggacctgaccggcggc
ctggcagaaagatggaacctgaagggcgtagcaggaagcggaggccagcaggacaggcca
ggccgctgggagcacaggacttgtcggcagctgctccacctgaaggaccagtgtctgatc
agctgctgcgtgctcagccccagagcaggtgcccgggagctgggggagttccatgccttc
attgtctcggacctgcgggagctccagggtcaggcgggccagtgcatcctgctgctgcgg
atccagaacccctggggccggcggtgctggcaggggctctggagagaggggggtgaaggg
tggagccaggtagatgcagcggtagcatctgagctcctgtcccagctccaggaaggggag
ttctgggtggaggaggaggagttcctcagggagtttgacgagctcaccgttggctacccg
gtcacggaggccggccacctgcagagcctctacacagagaggctgctctgccatacgcgg
gcgctgcctggggcctgggtcaagggccagtcagcaggaggctgccggaacaacagcggc
tttcccagcaaccccaaattctggctgcgggtctcagaaccgagtgaggtgtacattgcc
gtcctgcagagatccaggctgcacgcggcggactgggcaggccgggcccgggcactggtg
ggtgacagtcatacttcgtggagcccagcgagcatcccgggcaagcactaccaggctgtg
ggtctgcacctctggaaggtagagaagcggcgggtcaatctgcctagggtcctgtccatg
ccccccgtggctggcaccgcgtgccatgcatacgaccgggaggtccacctgcgttgtgag
ctctcaccgggctactacctggctgtccccagcaccttcctgaaggacgcgccaggggag
ttcctgctccgagtcttctctaccgggcgagtctcccttagcgccatcagggcagtggcc
aagaacaccacccccggggcagccctgcctgcgggggagtgggggaccgtgcagctacgg
ggttcttggagagtcggccagacggcggggggcagcaggaactttgcctcataccccacc
aacccctgcttccccttctcggtccccgagggccctggcccccgctgcgtccgcatcact
ctgcatcagcactgccggcccagtgacaccgagttccaccccatcggcttccatatcttc
caggtcccagagggtggaaggagccaggacgcacccccactgctgctgcaggagccgctg
ctgagctgcgtgccacatcgctacgcccaggaggtgagccggctctgcctcctgcctgcg
ggcacctacaaggttgtgccctccacctacctgccggacacagagggggccttcacagtg
accatcgcaaccaggattgacaggccatccattcacagccaggagatgctgggccagttc
ctccaagaggtctccgtcatggcagtgatgaaaacctaa

DBGET integrated database retrieval system