KEGG   Homo sapiens (human): 11143Help
Entry
11143             CDS       T01001                                 

Gene name
KAT7, HBO1, HBOA, MYST2, ZC2HC7
Definition
(RefSeq) lysine acetyltransferase 7 (EC:2.3.1.48)
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     11143 (KAT7)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    11143 (KAT7)
   HAT complexes
    HBO1 complex
     11143 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.32
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagaaagtgatggcacatcccgacgatctgct
cgagtcacccgctcctcagccaggctaagccagagttctcaagattccagtcctgttcga
aatctgcagtcttttggcactgaggagcctgcttactctaccagaagagtgacccgtagt
cagcagcagcctaccccagtgacaccgaaaaaataccctcttcggcagactcgttcatct
ggttcagaaactgagcaagtggttgatttttcagatagagaaactaaaaatacagctgat
catgatgagtcaccgcctcgaactccaactggaaatgcgccttcttctgagtctgacata
gacatctccagccccaatgtatctcacgatgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcatcgccccaagcgccgtcgcttccatgaaagctacaac
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacat
gagagacatttctccatctcaggatgcccactgtatcataacctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtctcacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacggagaggcagcttcgatat
aaggaaaaagtggctgaactcaggaagaaaagaaattctggactgagcaaagaacagaaa
gagaaatatatggaacacagacagacctatgggaacacacgggaacctcttttagaaaac
ctgacaagcgagtatgacttggatcttttccgaagagcacaagcccgggcttcagaggat
ttggagaagttaaggctgcaaggccaaatcacagagggaagcaacatgattaaaacaatt
gcttttggccgctatgagcttgatacctggtatcattctccatatcctgaagaatatgca
cggctgggacgtctctatatgtgtgaattctgtttaaaatatatgaagagccaaacgata
ctccgccggcacatggccaaatgtgtgtggaaacacccacctggtgatgagatatatcgc
aaaggttcaatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgttggccaaactttttctggaccacaagacattatattatgatgtggagccc
ttcctgttctatgttatgacagaggcggacaacactggctgtcacctgattggatatttt
tctaaggaaaagaattcattcctcaactacaacgtctcctgtatccttactatgcctcag
tacatgagacagggctatggcaagatgcttattgatttcagttatttgctttccaaagtc
gaagaaaaagttggctccccagaacgtccactctcagatctggggcttataagctatcgc
agttactggaaagaagtacttctccgctacctgcataattttcaaggcaaagagatttct
atcaaagaaatcagtcaggagacggctgtgaatcctgtggacattgtcagcactctgcaa
gcccttcagatgctcaaatactggaagggaaaacacctagttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaaaaggtccaactccaataaaaccatggatccc
agctgcttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system