KEGG   Homo sapiens (human): 11157Help
Entry
11157             CDS       T01001                                 

Gene name
LSM6, YDR378C
Definition
(RefSeq) LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12625  
U6 snRNA-associated Sm-like protein LSm6
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    11157 (LSM6)
  Folding, sorting and degradation
   03018 RNA degradation
    11157 (LSM6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     11157 (LSM6)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     11157 (LSM6)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    11157 (LSM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62312(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
4q31.22
AA seq 80 aa AA seqDB search
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKY
GDAFIRGNNVLYISTQKRRM
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcggaagcaaacccctagtgacttcttaaagcaaatcatcggacgaccagtt
gtggtaaaattaaattctggagtggattatcgaggggtcctggcttgcctggatggctac
atgaatatagccctggagcagacagaagaatatgtaaatggacaactgaagaataagtat
ggggatgcatttatccgaggaaacaatgtgttgtacatcagtacacagaagagacggatg
tga

KEGG   Homo sapiens (human): 23658Help
Entry
23658             CDS       T01001                                 

Gene name
LSM5, YER146W
Definition
(RefSeq) LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12624  
U6 snRNA-associated Sm-like protein LSm5
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    23658 (LSM5)
  Folding, sorting and degradation
   03018 RNA degradation
    23658 (LSM5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     23658 (LSM5)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     23658 (LSM5)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    23658 (LSM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y4Y9(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.3
AA seq 91 aa AA seqDB search
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEIT
PEGRRITKLDQILLNGNNITMLVPGGEGPEV
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcggctaacgctactaccaacccgtcgcagctgctgcccttagagcttgtggacaaa
tgtataggatcaagaattcacatcgtgatgaagagtgataaggaaattgttggtactctt
ctaggatttgatgactttgtcaatatggtactggaagatgtcactgagtttgaaatcaca
ccagaaggaagaaggattactaaattagatcagattttgctaaatggaaataatataaca
atgctggttcctggaggagaaggacctgaagtgtga

KEGG   Homo sapiens (human): 25804Help
Entry
25804             CDS       T01001                                 

Gene name
LSM4, GRP, YER112W
Definition
(RefSeq) LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12623  
U6 snRNA-associated Sm-like protein LSm4
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    25804 (LSM4)
  Folding, sorting and degradation
   03018 RNA degradation
    25804 (LSM4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     25804 (LSM4)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     25804 (LSM4)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    25804 (LSM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y4Z0(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.11
AA seq 139 aa AA seqDB search
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECY
IRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGI
PGTGRGQPEKKPGRQAGKQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccttgtcactgctgaagacggctcagaatcaccccatgttggtggagctgaaa
aatggggagacgtacaatggacacctggtgagctgcgacaactggatgaacattaacctg
cgagaagtcatctgcacgtccagggacggggacaagttctggcggatgcccgagtgctac
atccgcggcagcaccatcaagtacctgcgcatccccgacgagatcatcgacatggtcaag
gaggaggtggtggccaagggccgcggccgcggaggcctgcagcagcagaagcagcagaaa
ggccgcggcatgggcggcgctggccgaggtgtgtttggtggccggggccgaggtgggatc
ccgggcacaggcagaggccagccagagaagaagcctggcagacaggcgggcaaacagtga

KEGG   Homo sapiens (human): 27258Help
Entry
27258             CDS       T01001                                 

Gene name
LSM3, SMX4, USS2, YLR438C
Definition
(RefSeq) LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12622  
U6 snRNA-associated Sm-like protein LSm3
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    27258 (LSM3)
  Folding, sorting and degradation
   03018 RNA degradation
    27258 (LSM3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     27258 (LSM3)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     27258 (LSM3)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    27258 (LSM3)
 Complex C
  U2 snRNP components
    27258 (LSM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62310(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
3p25.1
AA seq 102 aa AA seqDB search
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEET
VTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgacgtagaccagcaacaaactaccaacactgtagaggagcccctggatctt
atcaggctcagcctagatgagcgaatttatgtgaaaatgagaaatgaccgagagcttcga
ggcagattacatgcttatgatcaacatttaaatatgatcttgggagatgtggaagaaact
gtgactactatagaaattgatgaagaaacatatgaagagatatataaatcaacgaaacgg
aatattccaatgctctttgtccggggagatggcgttgtcctggttgcccctccactgaga
gttggctga

KEGG   Homo sapiens (human): 51690Help
Entry
51690             CDS       T01001                                 

Gene name
LSM7, YNL147W
Definition
(RefSeq) LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12626  
U6 snRNA-associated Sm-like protein LSm7
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    51690 (LSM7)
  Folding, sorting and degradation
   03018 RNA degradation
    51690 (LSM7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51690 (LSM7)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     51690 (LSM7)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    51690 (LSM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UK45(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 103 aa AA seqDB search
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcggataaggagaagaagaaaaaggagagcatcttggacttgtccaagtacatcgac
aagacgatccgggtaaagttccagggaggccgcgaagccagtggaatcctgaagggcttc
gacccactcctcaaccttgtgctggacggcaccattgagtacatgcgagaccctgacgac
cagtacaagctcacggaggacacccggcagctgggcctcgtggtgtgccggggcacgtcc
gtggtgctaatctgcccgcaggacggcatggaggccatccccaaccccttcatccagcag
caggacgcctag

KEGG   Homo sapiens (human): 51691Help
Entry
51691             CDS       T01001                                 

Gene name
LSM8, NAA38
Definition
(RefSeq) LSM8 homolog, U6 small nuclear RNA associated
  KO
K12627  
U6 snRNA-associated Sm-like protein LSm8
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    51691 (LSM8)
  Folding, sorting and degradation
   03018 RNA degradation
    51691 (LSM8)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51691 (LSM8)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     51691 (LSM8)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    51691 (LSM8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95777(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
7q31.31
AA seq 96 aa AA seqDB search
MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLY
IVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccgctttggagaactacatcaaccgaactgttgccgttattacatcagatggg
agaatgattgtgggaacactgaaaggttttgaccagaccattaatttgattttggatgaa
agccatgaacgagtattcagctcttcacagggggtagaacaagtggtactaggattatac
attgtaagaggtgacaacgttgcagtcattggagaaatcgatgaagaaacagattctgcg
cttgatttggggaatattcgagcagaacctttaaattctgtagcacactga

KEGG   Homo sapiens (human): 57819Help
Entry
57819             CDS       T01001                                 

Gene name
LSM2, C6orf28, G7B, YBL026W, snRNP
Definition
(RefSeq) LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12621  
U6 snRNA-associated Sm-like protein LSm2
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    57819 (LSM2)
  Folding, sorting and degradation
   03018 RNA degradation
    57819 (LSM2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     57819 (LSM2)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     57819 (LSM2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    57819 (LSM2)
 Complex C
  U2 snRNP components
    57819 (LSM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y333(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 95 aa AA seqDB search
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC
FIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgctcttctattcttttttcaagtcccttgtgggcaaggatgtggtcgtggaactaaag
aatgacctgagcatctgtggaaccctccattctgtggatcagtatctcaacatcaaacta
actgacatcagtgtcacagaccctgagaaataccctcacatgttatcagtgaagaactgc
ttcattcggggctcagtggtccgatacgtgcagctgccagcagatgaggtcgacacacag
ttgctacaggatgcggcaaggaaggaagccctgcagcagaaacagtga

DBGET integrated database retrieval system