KEGG   Homo sapiens (human): 11171Help
Entry
11171             CDS       T01001                                 

Gene name
STRAP, MAWD, PT-WD, UNRIP
Definition
serine/threonine kinase receptor associated protein
Orthology
K13137  
serine-threonine kinase receptor-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    11171 (STRAP)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    11171 (STRAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p12.3
AA seq 350 aa AA seqDB search
MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKG
AVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQ
DKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSL
NFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVA
GGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTY
GLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgagacagacgccgctcacctgctctggccacacgcgacccgtggttgatttg
gccttcagtggcatcacgccttatgggtatttcttaatcagcgcttgcaaagatggtaaa
cctatgctacgccagggagatacaggagactggattggaacatttttgggtcataaaggt
gctgtttggggtgcaacactgaataaggatgccaccaaagcagctacagcagctgcagat
ttcacagccaaagtgtgggatgctgtctcaggagatgaattgatgaccctggctcataaa
cacattgtcaagactgtggatttcacgcaggatagtaattatttgttaaccgggggacag
gataaactgttacgcatatatgacttgaacaaacctgaagcagaacctaaggaaattagt
ggtcatacttctggtataaaaaaagctctgtggtgcagtgaggataaacagattctttct
gctgatgacaaaactgttcgactttgggatcatgctactatgacagaagtgaaatctcta
aattttaatatgtctgttagtagtatggaatatattcctgagggagagattttggttata
acttatggacgatctattgcttttcatagtgcagtaagtttggacccaattaaatccttt
gaagctcctgcaaccatcaattctgcatctcttcatcctgagaaagaatttcttgttgca
ggcggtgaagattttaaactttataagtatgattataatagtggagaagaattagaatcc
tacaagggacactttggtcctattcactgtgtgagatttagtcctgatggagaactctat
gccagtggttcagaagatggaacattgagactatggcaaactgtggtaggaaaaacgtat
ggcctttggaaatgtgtgcttcctgaagaagatagtggtgagctggcaaagccaaagatt
ggttttccagagacaacagaagaggagctagaagaaattgcttcagagaattcagattgc
atctttccttcagctcctgatgttaaggcctga

DBGET integrated database retrieval system