KEGG   Homo sapiens (human): 1118Help
Entry
1118              CDS       T01001                                 

Gene name
CHIT1, CHI3, CHIT, CHITD
Definition
chitinase 1 (chitotriosidase) (EC:3.2.1.14)
Orthology
K01183  
chitinase [EC:3.2.1.14]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    1118 (CHIT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     1118 (CHIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 447 aa AA seqDB search
MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAG
MTNHQLSTTEWNDETLYQEFNGLKKMFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDW
EYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDK
IAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASK
LILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQD
QKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQ
TLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFYS
CAAGRLFQQSCPTGLVFSNSCKCCTWN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggtctgtggcctgggcaggtttcatggtcctgctgatgatcccatggggctct
gctgcaaaactggtctgctacttcaccaactgggcccagtacagacagggggaggctcgc
ttcctgcccaaggacttggaccccagcctttgcacccacctcatctacgccttcgctggc
atgaccaaccaccagctgagcaccactgagtggaatgacgagactctctaccaggagttc
aatggcctgaagaagatgttcacagatatggtagccacggccaacaaccgtcagaccttt
gtcaactcggccatcaggtttctgcgcaaatacagctttgacggccttgaccttgactgg
gagtacccaggaagccaggggagccctgccgtagacaaggagcgcttcacaaccctggta
caggacttggccaatgccttccagcaggaagcccagacctcagggaaggaacgccttctt
ctgagtgcagcggttccagctgggcagacctatgtggatgctggatacgaggtggacaaa
atcgcccagaacctggattttgtcaaccttatggcctacgacttccatggctcttgggag
aaggtcacgggacataacagccccctctacaagaggcaagaagagagtggtgcagcagcc
agcctcaacgtggatgctgctgtgcaacagtggctgcagaaggggacccctgccagcaag
ctgatccttggcatgcctacctacggacgctccttcacactggcctcctcatcagacacc
agagtgggggccccagccacagggtctggcactccaggccccttcaccaaggaaggaggg
atgctggcctactatgaagtctgctcctggaagggggccaccaaacagagaatccaggat
cagaaggtgccctacatcttccgggacaaccagtgggtgggctttgatgatgtggagagc
ttcaaaaccaaggtcagctatctgaagcagaagggactgggcggggccatggtctgggca
ctggacttagatgactttgccggcttctcctgcaaccagggccgataccccctcatccag
acgctacggcaggaactgagtcttccatacttgccttcaggcaccccagagcttgaagtt
ccaaaaccaggtcagccctctgaacctgagcatggccccagccctggacaagacacgttc
tgccagggcaaagctgatgggctctatcccaatcctcgggaacggtccagcttctacagc
tgtgcagcggggcggctgttccagcaaagctgcccgacaggcctggtgttcagcaactcc
tgcaaatgctgcacctggaattga

DBGET integrated database retrieval system