KEGG   Homo sapiens (human): 11182Help
Entry
11182             CDS       T01001                                 

Gene name
SLC2A6, GLUT6, GLUT9, HSA011372
Definition
(RefSeq) solute carrier family 2 member 6
  KO
K08144  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 6
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   11182 (SLC2A6)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    11182 (SLC2A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 507 aa AA seqDB search
MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS
PVIPALERSLDPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSA
AGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFG
SLSLYALGLLLPWRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT
DVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQS
IFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMFAANLTLGLYI
HFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTG
CCVPETKGRSLEQIESFFRTGRRSFLR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagccgctgctgggagccgagggcccggactacgacaccttccccgagaagccg
cccccgtcgccaggggacagggcgcgggtcgggaccctgcagaacaaaagggtgttcctg
gccaccttcgccgcagtgctcggcaatttcagctttgggtatgccctggtctacacatcc
cctgtcatcccagccctggagcgctccttggatcctgacctgcatctgaccaaatcccag
gcatcctggtttgggtccgtgttcaccctgggagcagcggccggaggcctgagtgccatg
atcctcaacgacctcctgggccggaagctgagcatcatgttctcagctgtgccgtcggcg
gccggctatgcgctcatggcgggtgcgcacggcctctggatgctgctgctcggaaggacg
ctgacgggcttcgccggggggctcacagctgcctgcatcccggtgtacgtgtctgagatt
gctcccccaggcgttcgtggggctctgggggccacaccccagctcatggcagtgttcgga
tccctgtccctctacgcccttggcctcctgctgccgtggcgctggctggctgtggccggg
gaggcgcctgtgctcatcatgatcctgctgctcagcttcatgcccaactcgccgcgcttc
ctgctctctcggggcagggacgaagaggccctgcgggcgctggcctggctgcgtgggacg
gacgtcgatgtccactgggagttcgagcagatccaggacaacgtccggagacagagcagc
cgagtatcgtgggctgaggcacgggccccacacgtgtgccggcccatcaccgtggccttg
ctgatgcgcctcctgcagcagctgacgggcatcacgcccatcctggtctacctgcagtcc
atcttcgacagcaccgctgtcctgctgccccccaaggacgacgcagccatcgttggggcc
gtgcggctcctgtccgtgctgatcgccgccctcaccatggacctcgcaggccgcaaggtg
ctgctcttcgtctcagcggccatcatgtttgctgccaacctgactctggggctgtacatc
cactttggccccaggcctctgagccccaacagcactgcgggcctggaaagcgagtcctgg
ggggacttggcgcagcccctggcagcacccgctggctacctcaccctggtgcccctgctg
gccaccatgctcttcatcatgggctacgccgtgggctggggtcccatcacctggctgctc
atgtctgaggtcctgcccctgcgtgcccgtggcgtggcctcagggctctgcgtgctggcc
agctggctcaccgccttcgtcctcaccaagtccttcctgccagtggtgagcaccttcggc
ctccaggtgcctttcttcttcttcgcggccatctgcttggtgagcctggtgttcacaggc
tgctgtgtgcccgagaccaagggacggtccctggagcagatcgagtccttcttccgcacg
gggagaaggtccttcttgcgctag

DBGET integrated database retrieval system