KEGG   Homo sapiens (human): 11184Help
Entry
11184             CDS       T01001                                 

Gene name
MAP4K1, HPK1
Definition
mitogen-activated protein kinase kinase kinase kinase 1 (EC:2.7.11.1)
Orthology
K04408  
mitogen-activated protein kinase kinase kinase kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    11184 (MAP4K1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11184 (MAP4K1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   11184 (MAP4K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1-q13.4
AA seq 821 aa AA seqDB search
MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQ
KEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCRE
VLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMA
PEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEK
GKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSI
GDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQP
PRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQL
SPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMK
RKGCALLVKLFNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPS
RTTWVYSINNVLMSLSGKTPHLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTK
IQDTKGCRACCVAEGASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLSVF
ALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWLGEMSTEHRGPVQVTQVEEDM
VMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHGVQVWALGSDQ
LLQELRDPTLTFRLLGSPRPVVVETRPVDDPTAPSNLYIQE
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtggaccctgacattttcaatagagacccccgggaccactatgacctgcta
cagcggctgggtggcggcacgtatggggaagtctttaaggctcgagacaaggtgtcaggg
gacctggtggcactgaagatggtgaagatggagcctgatgatgatgtctccacccttcag
aaggaaatcctcatattgaaaacttgccggcacgccaacatcgtggcctaccatgggagt
tatctctggttgcagaaactctggatctgcatggaattctgtggggctggttctctccag
gacatctaccaagtgacaggctccctgtcagagctccagattagctatgtctgccgggaa
gtgctccagggactggcctatttgcactcacagaagaagatacacagggacatcaaggga
gctaacatcctcatcaatgatgctggggaggtcagattggctgactttggcatctcggcc
cagattggggctacactggccagacgcctctctttcattgggacaccctactggatggct
ccggaagtggcagctgtggccctgaagggaggatacaatgagctgtgtgacatctggtcc
ctgggcatcacggccatcgaactggccgagctacagccaccgctctttgatgtgcaccct
ctcagagttctcttcctcatgaccaagagtggctaccagcctccccgactgaaggaaaaa
ggcaaatggtcggctgccttccacaacttcatcaaagtcactctgactaagagtcccaag
aaacgacccagcgccaccaagatgctcagtcatcaactggtatcccagcctgggctgaat
cgaggcctgatcctggatcttcttgacaaactgaagaatcccgggaaaggaccctccatt
ggggacattgaggatgaggagcccgagctaccccctgctatccctcggcggatcagatcc
acccaccgctccagctctctggggatcccagatgcagactgctgtcggcggcacatggag
ttcaggaagctccgaggaatggagaccagacccccagccaacaccgctcgcctacagcct
cctcgagacctcaggagcagcagccccaggaagcaactgtcagagtcgtctgacgatgac
tatgacgacgtggacatccccacccctgcagaggacacacctcctccacttccccccaag
cccaagttccgttctccatcagacgagggtcctgggagcatgggggatgatgggcagctg
agcccgggggtgctggtccggtgtgccagtgggcccccaccaaacagcccccgtcctggg
cctcccccatccaccagcagcccccacctcaccgcccattcagaaccctcactctggaac
ccaccctcccgggagcttgacaagcccccacttctgccccccaagaaggaaaagatgaag
agaaagggatgtgcccttctcgtaaagttgttcaatggctgccccctccggatccacagc
acggccgcctggacacatccctccaccaaggaccagcacctgctcctgggggcagaggaa
ggcatcttcatcctgaaccggaatgaccaggaggccacgctggaaatgctctttcctagc
cggactacgtgggtgtactccatcaacaacgttctcatgtctctctcaggaaagaccccc
cacctgtattctcatagcatccttggcctgctggaacggaaagagaccagagcaggaaac
cccatcgctcacattagcccccaccgcctactggcaaggaagaacatggtttccaccaag
atccaggacaccaaaggctgccgggcgtgctgtgtggcggagggtgcgagctctgggggc
ccgttcctgtgcggtgcattggagacgtccgttgtcctgcttcagtggtaccagcccatg
aacaaattcctgcttgtccggcaggtgctgttcccactgccgacgcctctgtccgtgttc
gcgctgctgaccgggccaggctctgagctgcccgctgtgtgcatcggcgtgagccccggg
cggccggggaagtcggtgctcttccacacggtgcgctttggcgcgctctcttgctggctg
ggcgagatgagcaccgagcacaggggacccgtgcaggtgacccaggtagaggaagatatg
gtgatggtgttgatggatggctctgtgaagctggtgaccccggaggggtccccagtccgg
ggacttcgcacacctgagatccccatgaccgaagcggtggaggccgtggctatggttgga
ggtcagcttcaggccttctggaagcatggagtgcaggtgtgggctctaggctcggatcag
ctgctacaggagctgagagaccctaccctcactttccgtctgcttggctcccccaggcct
gtagtggtggagacacgcccagtggatgatcctactgctcccagcaacctctacatccag
gaatga

DBGET integrated database retrieval system