KEGG   Homo sapiens (human): 11186Help
Entry
11186             CDS       T01001                                 

Gene name
RASSF1, 123F2, NORE2A, RASSF1A, RDA32, REH3P21
Definition
Ras association (RalGDS/AF-6) domain family member 1
Orthology
K09850  
Ras association domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Hippo signaling pathway
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Non-small cell lung cancer
Disease
H00014  
Non-small cell lung cancer
H00022  
Bladder cancer
H00054  
Nasopharyngeal cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 189 aa AA seqDB search
MSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAV
KHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLL
AGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQ
EALHACPLG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgaacaaggacggttcttacacaggcttcatcaaggttcagctgaagctggtg
cgccctgtctctgtgccctccagcaagaagccaccctccttgcaggatgcccggcggggc
ccaggacggggcacaagtgtcaggcgccgcacttccttttacctgcccaaggatgctgtc
aagcacctgcatgtgctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcga
aagttcttggtggtggatgacccccgcaagtttgcactctttgagcgcgctgagcgtcac
ggccaagtgtacttgcggaagctgttggatgatgagcagcccctgcggctgcggctcctg
gcagggcccagtgacaaggccctgagctttgtcctgaaggaaaatgactctggggaggtg
aactgggacgccttcagcatgcctgaactacataacttcctacgtatcctgcagcgggag
gaggaggagcacctccgccagatcctgcagaagtactcctattgccgccagaagatccaa
gaggccctgcacgcctgcccccttgggtga

DBGET integrated database retrieval system