KEGG   Homo sapiens (human): 11186Help
Entry
11186             CDS       T01001                                 

Gene name
RASSF1, 123F2, NORE2A, RASSF1A, RDA32, REH3P21
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  
Ras association domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Hippo signaling pathway
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Non-small cell lung cancer
Disease
H00014  
Non-small cell lung cancer
H00022  
Bladder cancer
H00054  
Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    11186 (RASSF1)
   04390 Hippo signaling pathway
    11186 (RASSF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11186 (RASSF1)
   05206 MicroRNAs in cancer
    11186 (RASSF1)
   05219 Bladder cancer
    11186 (RASSF1)
   05223 Non-small cell lung cancer
    11186 (RASSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 344 aa AA seqDB search
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg
aagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc
aaccccacacggcagctggtccctggccgtggccaccgcttccagcccgcggggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaaaggcctg
cagtgcgcgcgcctctctgcagattgcaagttcacctgccactaccgctgccgcgcgctc
gtctgcctggactgttgcgggccccgggacctgggctgggaacccgcggtggagcgggac
acgaacgtggacgagcctgtggagtgggagacacctgacctttctcaagctgagattgag
cagaagatcaaggagtacaatgcccagatcaacagcaacctcttcatgagcttgaacaag
gacggttcttacacaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtg
ccctccagcaagaagccaccctccttgcaggatgcccggcggggcccaggacggggcaca
agtgtcaggcgccgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtg
ctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtg
gatgacccccgcaagtttgcactctttgagcgcgctgagcgtcacggccaagtgtacttg
cggaagctgttggatgatgagcagcccctgcggctgcggctcctggcagggcccagtgac
aaggccctgagctttgtcctgaaggaaaatgactctggggaggtgaactgggacgccttc
agcatgcctgaactacataacttcctacgtatcctgcagcgggaggaggaggagcacctc
cgccagatcctgcagaagtactcctattgccgccagaagatccaagaggccctgcacgcc
tgcccccttgggtga

DBGET integrated database retrieval system