KEGG   Homo sapiens (human): 1119Help
Entry
1119              CDS       T01001                                 

Gene name
CHKA, CHK, CK, CKI, EK
Definition
choline kinase alpha (EC:2.7.1.32 2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Choline metabolism in cancer
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    1119 (CHKA)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    1119 (CHKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     1119 (CHKA)
    2.7.1.82  ethanolamine kinase
     1119 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.2
AA seq 457 aa AA seqDB search
MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPP
PPLPLPLPLPQPPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGL
SNMLFQCSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLE
SVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKM
PFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPV
VFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYP
FFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW
GLWSIVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattctgcaccgggggcgaggcggagccctcgccgctcgggctgctgctg
agctgcggtagcggcagcgcggccccggcgcccggcgtggggcagcagcgcgacgccgcc
agcgacctcgagtccaagcagctgggcggccaacagccgccgctcgcgctgccccctccg
ccgccgctgccgctgccgctgccgctgccccagcccccgccgccgcagccgcccgcagac
gagcagccggagccccggacgcggcgcagggcctatctgtggtgcaaggagttcctgccc
ggcgcctggcggggcctccgcgaggacgagttccacatcagtgtcatcagaggcggcctt
agcaacatgctgttccagtgctccctacctgacaccacagccacccttggtgatgagcct
cggaaagtgctcctgcggctgtatggagcgattttgcagatgaggtcctgtaataaagag
ggatccgaacaagctcagaaagaaaatgaatttcaaggggctgaggccatggttctggag
agcgttatgtttgccattctcgcagagaggtcacttgggccaaaactctatggcatcttt
ccccaaggccgactggagcagttcatcccgagccggcgattagatactgaagaattaagt
ttgccagatatttctgcagaaatcgccgagaaaatggctacatttcatggtatgaaaatg
ccattcaataaggaaccaaaatggctttttggcacaatggaaaagtatctaaaggaagtg
ctgagaattaaatttactgaggaatccagaattaaaaagctccacaaattgctcagttac
aatctgcccttggaactggaaaacctgagatcattgcttgaatctactccatctccagtt
gtattttgtcataatgactgtcaagaaggtaatatcttgttgctggaaggccgagagaat
tctgaaaaacagaaactgatgctcattgatttcgaatacagcagttacaattacagggga
ttcgacattggaaatcacttctgtgagtggatgtatgattatagctatgaaaaataccct
tttttcagagcaaacatccggaagtatcccaccaagaaacaacagctccattttatttcc
agttacttgcctgcattccaaaatgactttgaaaacctcagtactgaagaaaaatccatt
ataaaagaagaaatgttgcttgaagttaataggtttgcccttgcatctcatttcctctgg
ggactgtggtccattgtacaagccaagatttcatctattgaatttgggtacatggactac
gcccaagcaaggtttgatgcctatttccaccagaagaggaagcttggggtgtga

DBGET integrated database retrieval system