KEGG   Homo sapiens (human): 11194Help
Entry
11194             CDS       T01001                                 

Gene name
ABCB8, EST328128, M-ABC1, MABC1
Definition
ATP-binding cassette, sub-family B (MDR/TAP), member 8
Orthology
K05655  
ATP-binding cassette, subfamily B (MDR/TAP), member 8
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    11194 (ABCB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q36
AA seq 735 aa AA seqDB search
MLVHLFRVGIRGGPFPGRLLPPLRFQTFSAVRNTWRNGKTGQLHKAEGEYSDGYRSSSLL
RAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPP
ASSTPHVVGSRFNWKLFWQFLHPHLLVLGVAVVLALGAALVNVQIPLLLGQLVEVVAKYT
RDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDI
TFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMV
ATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAE
LEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQT
VQRSMANLSVLFGQVVRGLSAGARVFEYMALNPCIPLSGGCCVPKEQLRGSVTFQNVCFS
YPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRT
LDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEG
YNTVVGERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAG
RTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALDAPRTAAP
PPKKPEGPRSHQHKS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgcatttatttcgggtcgggattcggggtggcccattcccaggcaggctgcta
ccgcccctccgcttccagacattctcagctgtcagaaacacatggcgtaatgggaaaact
ggacagttacacaaggcagaaggagagtactctgatggctaccgcagctcctccctcctc
cgggccgtggcccacctgcggtcccagctctgggcccacctccctcgagcccccctagct
cccagatggagcccctctgcctggtgctgggttgggggagccctgctaggccccatggta
ctgagtaagcatccccacctctgccttgtggccctgtgtgaggcagaagaggcccctcct
gccagctccacaccccatgtcgtggggtctcgctttaactggaagctcttctggcagttt
ctgcacccccacctgctggtcctgggggtagccgtcgtgctggccttgggtgcggcactc
gtgaatgtacagatccccctgctcctgggccagctggtagaggtcgtggccaagtacaca
agggaccacgtagggagtttcatgactgagtcccagaatctcagcacccacctgcttatc
ctctatggtgtccagggactgctgaccttcgggtacctggtgctgctgtcccacgttggc
gagcgcatggctgtggacatgcggagggccctcttcagctccctgctccgacaagacatc
accttctttgacgccaataagacagggcagctggtgagccgcttgacaactgacgtgcag
gagtttaagtcatccttcaagcttgtcatctcccaggggctgcgaagctgcacccaggtg
gcaggctgcctggtgtccctgtccatgctgtcgacacgcctcacgctgctgctgatggtg
gccacaccagccctgatgggagtgggcaccctgatgggctcaggcctccgaaaattgtct
cgccagtgtcaggagcagatcgccagggcaatgggcgtagcagacgaggccctgggcaat
gtgcggactgtgcgtgccttcgccatggagcaacgggaagaggagcgctatggggcagag
ctggaagcctgccgctgccgggcagaggagctgggccgcggcatcgccttgttccaaggg
ctttccaacatcgccttcaactgcatggtcttgggtaccctatttattgggggctccctt
gtggccggacagcagctgacagggggagacctcatgtccttcctggtggcctcccagaca
gtgcaaaggtccatggccaacctctctgtcctgtttgggcaggtggtccgggggctgagt
gcaggtgcccgggtctttgagtacatggccctgaacccctgcatcccactgtctgggggc
tgctgcgtccccaaagagcagctgcgtggctccgttacatttcagaacgtctgcttcagc
tacccctgccgccccggcttcgaggtgctgaaagacttcaccctgacgctgccccctggc
aagatcgtggccctcgtgggccagtctggcggaggaaagaccaccgtggcttccctgctg
gagcgcttctacgaccccacggcaggcgtggtgatgctggatgggcgggacctgcgcacc
cttgacccctcctggctccggggccaggttgtcggcttcatcagccaggagcccgtcctg
tttgggacgaccatcatggaaaacatccgctttgggaagctggaagcttccgatgaagag
gtgtacacagccgcccgggaagcgaatgctcacgagttcatcaccagcttccccgagggc
tacaacacggtcgtcggtgaacggggcactaccctgtctgggggccagaagcagcgcctg
gccatcgcccgagcccttatcaagcagcccacggtgctgatactggatgaagctaccagc
gcgctggatgcagagtccgagcgggttgtacaggaggccctggaccgggccagtgcaggc
cgcacggtgctggtaattgcccaccggctcagcactgtccgtggggcccactgcattgtc
gtcatggccgatggccgtgtctgggaggctgggacacatgaagagctcctgaagaaaggc
gggctatacgccgagctcatccggaggcaggccctggatgccccgaggacagcggcccca
ccgcccaaaaagccagaaggccccaggagccaccagcacaagtcctga

DBGET integrated database retrieval system