KEGG   Homo sapiens (human): 11198Help
Entry
11198             CDS       T01001                                 

Gene name
SUPT16H, CDC68, FACTP140, SPT16, SPT16/CDC68
Definition
(RefSeq) SPT16 homolog, facilitates chromatin remodeling subunit
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SPT16 FACT-Spt16_Nlob Peptidase_M24 Rtt106 DUF1949
Motif
Other DBs
NCBI-GeneID: 11198
NCBI-ProteinID: NP_009123
OMIM: 605012
HGNC: 11465
Ensembl: ENSG00000092201
Vega: OTTHUMG00000029685
Pharos: Q9Y5B9(Tbio)
UniProt: Q9Y5B9
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 1047 aa AA seqDB search
MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYE
LTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDK
MIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGEL
NLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVE
MCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQE
NYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGS
LVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTS
VKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKE
LAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIM
PVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITY
RASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNP
KLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVL
HFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAF
KNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEV
ELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSL
NWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEE
DSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR
KASVHSSGRGSNRGSRHSSAPPKKKRK
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgactctggacaaagacgcttattatcggcgagtgaagagactgtacagcaat
tggcggaaaggagaagatgagtatgccaacgttgatgccattgttgtatcagtgggtgtt
gatgaagaaattgtttatgccaaatcaactgccttacagacatggctctttggttatgaa
ctaactgatactatcatggtcttttgtgatgacaaaatcatctttatggccagcaagaaa
aaagtggagttcttgaaacagattgccaacactaagggcaatgagaatgctaatggagcc
cctgccatcacactgctaatacgagaaaagaatgaaagtaataagagtagctttgacaaa
atgattgaagccattaaagaaagcaagaatggcaagaagattggagtgttcagcaaagac
aaattccctggagagttcatgaagagctggaatgactgcctcaacaaagaaggctttgac
aaaatagatatcagtgcagttgtggcatataccatcgctgtaaaggaggatggggagctc
aacctaatgaagaaagcagccagcatcacttctgaagtcttcaacaaattcttcaaggaa
agagtcatggaaatagttgatgcagatgagaaagttcgacacagcaaactggctgagtct
gtggaaaaggccattgaagagaaaaaataccttgctggggcagacccttctactgtggaa
atgtgttaccctcctatcattcagagtggtggcaactataatctcaagttcagtgtggtg
agtgacaagaatcatatgcactttggggctatcacttgtgccatgggtattcgcttcaag
tcttactgctccaaccttgttcgcactttgatggttgatccttctcaagaagttcaagaa
aattataactttttgctccagcttcaagaggagctgctgaaggaattaagacatggtgtg
aagatatgtgacgtgtataacgctgtcatggacgtggttaaaaagcagaagccagaactg
ctgaacaaaattaccaaaaacctagggtttgggatgggaattgaattccgtgaaggctcc
ctagtaatcaatagcaaaaatcaatacaaactgaagaaaggaatggttttcagcatcaat
ttaggattctcagacctgactaacaaggaggggaaaaagccagaagagaaaacctatgcc
ctgttcattggtgacacagtgcttgtggatgaggatggcccagctactgttctcacttct
gtgaagaagaaagtgaagaatgtggggattttcctaaagaatgaagatgaggaagaagag
gaggaggagaaagatgaggcagaggaccttttgggaagaggttctcgggcagcattactt
acagaaagaacaagaaatgaaatgactgcagaagagaagcgaagagcacatcagaaagaa
ctagcggctcaactcaatgaagaagcaaagaggcgattgactgaacaaaagggagaacag
cagattcagaaagctcgcaagtctaatgtgtcctataaaaacccatctctgatgcctaag
gaaccacatattcgggaaatgaagatctacatcgataagaaatatgagactgtaataatg
cccgtgtttggcattgcaacaccgtttcacattgccacaatcaagaatataagtatgtcc
gtggaaggagattatacttacttgcgaatcaacttttattgcccaggcagtgctctgggc
aggaatgaaggcaacatctttcctaaccctgaagcgacttttgtcaaggaaattacatac
cgagcatcaaatattaaggcacccggagaacagacagtaccagccttgaaccttcagaat
gctttccgaattattaaagaagtacagaaacgttataaaactcgagaagctgaagagaaa
gagaaggaggggattgtaaaacaagactcactggtgatcaatctaaaccggagtaatccg
aaactgaaagatctatacattcgcccaaatattgcccaaaagaggatgcaaggctcactg
gaggcccatgtcaatggcttccgcttcacatctgttcgaggagacaaagtggatattttg
tacaataatattaagcatgctttgttccagccctgtgatggagaaatgattattgtcttg
cactttcacctcaagaatgccatcatgtttgggaagaagcggcacacggatgtgcagttc
tacacagaagtgggagagataaccacggacttggggaaacatcagcatatgcatgaccga
gatgacctctatgctgagcagatggaacgagaaatgaggcacaaactgaaaacagccttt
aaaaatttcattgagaaagtagaggctctaactaaggaggaactggaatttgaagtgcct
tttagggacttgggatttaacggagctccctataggagtacctgcctccttcagcccact
agtagtgcgctggtaaatgctacggaatggccaccttttgtggtgacattggatgaggta
gagctgatccactttgagcgggtccagtttcacctgaagaactttgatatggtaatcgtc
tacaaggactacagcaagaaagtgaccatgatcaacgccattcctgtagcctctcttgac
cccatcaaggaatggttgaattcctgcgacctgaaatacacagaaggagtacagtccctc
aactggactaaaatcatgaagaccattgttgatgaccctgagggcttcttcgaacaaggt
ggctggtctttcctggagcctgagggtgaggggagtgatgctgaagaaggggattcagag
tctgaaattgaagatgagacttttaatccttcagaagatgactatgaagaggaagaggag
gacagtgatgaagattattcatcagaagcagaagagtcagactattctaaggagtcattg
ggtagtgaagaagagagtggaaaggattgggatgaactggaggaagaagcccgaaaagcg
gaccgagaaagtcgttacgaggaagaagaagaacaaagtcgaagtatgagccggaagagg
aaggcatctgtgcacagttcgggccgtggctctaaccgtggttccagacacagctctgca
ccccccaagaaaaagaggaagtaa

DBGET integrated database retrieval system