KEGG   Homo sapiens (human): 11200Help
Entry
11200             CDS       T01001                                 

Gene name
CHEK2, CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53, hCds1
Definition
checkpoint kinase 2 (EC:2.7.11.1)
Orthology
K06641  
serine/threonine-protein kinase Chk2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
HTLV-I infection
Disease
H00881  
Li-Fraumeni syndrome
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.1
AA seq 586 aa AA seqDB search
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLETESGHVTQSDLEL
LLSSDPPASASQSAGIRGVRHHPRPVCSLKCVNDNYWFGRDKSCEYCFDEPLLKRTDKYR
TYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNK
VFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFA
IGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNK
RLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGE
TSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLK
DQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQD
LLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCAAVL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgggagtcggatgttgaggctcagcagtctcatggcagcagtgcctgttcacag
ccccatggcagcgttacccagtcccaaggctcctcctcacagtcccagggcatatccagc
tcctctaccagcacgatgccaaactccagccagtcctctcactccagctctgggacactg
agctccttagagacagtgtccactcaggaactctattctattcctgaggaccaagaacct
gaggaccaagaacctgaggagcctacccctgccccctgggctcgattatgggcccttcag
gatggatttgccaatcttgagacagagtctggccatgttacccaatctgatcttgaactc
ctgctgtcatctgatcctcctgcctcagcctcccaaagtgctgggataagaggtgtgagg
caccatccccggccagtttgcagtctaaaatgtgtgaatgacaactactggtttgggagg
gacaaaagctgtgaatattgctttgatgaaccactgctgaaaagaacagataaataccga
acatacagcaagaaacactttcggattttcagggaagtgggtcctaaaaactcttacatt
gcatacatagaagatcacagtggcaatggaacctttgtaaatacagagcttgtagggaaa
ggaaaacgccgtcctttgaataacaattctgaaattgcactgtcactaagcagaaataaa
gtttttgtcttttttgatctgactgtagatgatcagtcagtttatcctaaggcattaaga
gatgaatacatcatgtcaaaaactcttggaagtggtgcctgtggagaggtaaagctggct
ttcgagaggaaaacatgtaagaaagtagccataaagatcatcagcaaaaggaagtttgct
attggttcagcaagagaggcagacccagctctcaatgttgaaacagaaatagaaattttg
aaaaagctaaatcatccttgcatcatcaagattaaaaacttttttgatgcagaagattat
tatattgttttggaattgatggaagggggagagctgtttgacaaagtggtggggaataaa
cgcctgaaagaagctacctgcaagctctatttttaccagatgctcttggctgtgcagtac
cttcatgaaaacggtattatacaccgtgacttaaagccagagaatgttttactgtcatct
caagaagaggactgtcttataaagattactgattttgggcactccaagattttgggagag
acctctctcatgagaaccttatgtggaacccccacctacttggcgcctgaagttcttgtt
tctgttgggactgctgggtataaccgtgctgtggactgctggagtttaggagttattctt
tttatctgccttagtgggtatccacctttctctgagcataggactcaagtgtcactgaag
gatcagatcaccagtggaaaatacaacttcattcctgaagtctgggcagaagtctcagag
aaagctctggaccttgtcaagaagttgttggtagtggatccaaaggcacgttttacgaca
gaagaagccttaagacacccgtggcttcaggatgaagacatgaagagaaagtttcaagat
cttctgtctgaggaaaatgaatccacagctctaccccaggttctagcccagccttctact
agtcgaaagcggccccgtgaaggggaagccgagggtgccgagaccacaaagcgcccagct
gtgtgtgctgctgtgttgtga

DBGET integrated database retrieval system