KEGG   Homo sapiens (human): 11200Help
Entry
11200             CDS       T01001                                 

Gene name
CHEK2, CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53, hCds1
Definition
(RefSeq) checkpoint kinase 2
  KO
K06641  
serine/threonine-protein kinase Chk2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
HTLV-I infection
Module
DNA damage-induced cell cycle checkpoints
Disease
H00881  
Li-Fraumeni syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    11200 (CHEK2)
   04115 p53 signaling pathway
    11200 (CHEK2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    11200 (CHEK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11200 (CHEK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  RAD53 family
   11200 (CHEK2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    11200 (CHEK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.1
AA seq 543 aa AA seqDB search
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS
CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR
RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER
KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE
DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA
LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA
AVL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgggagtcggatgttgaggctcagcagtctcatggcagcagtgcctgttcacag
ccccatggcagcgttacccagtcccaaggctcctcctcacagtcccagggcatatccagc
tcctctaccagcacgatgccaaactccagccagtcctctcactccagctctgggacactg
agctccttagagacagtgtccactcaggaactctattctattcctgaggaccaagaacct
gaggaccaagaacctgaggagcctacccctgccccctgggctcgattatgggcccttcag
gatggatttgccaatcttgaatgtgtgaatgacaactactggtttgggagggacaaaagc
tgtgaatattgctttgatgaaccactgctgaaaagaacagataaataccgaacatacagc
aagaaacactttcggattttcagggaagtgggtcctaaaaactcttacattgcatacata
gaagatcacagtggcaatggaacctttgtaaatacagagcttgtagggaaaggaaaacgc
cgtcctttgaataacaattctgaaattgcactgtcactaagcagaaataaagtttttgtc
ttttttgatctgactgtagatgatcagtcagtttatcctaaggcattaagagatgaatac
atcatgtcaaaaactcttggaagtggtgcctgtggagaggtaaagctggctttcgagagg
aaaacatgtaagaaagtagccataaagatcatcagcaaaaggaagtttgctattggttca
gcaagagaggcagacccagctctcaatgttgaaacagaaatagaaattttgaaaaagcta
aatcatccttgcatcatcaagattaaaaacttttttgatgcagaagattattatattgtt
ttggaattgatggaagggggagagctgtttgacaaagtggtggggaataaacgcctgaaa
gaagctacctgcaagctctatttttaccagatgctcttggctgtgcagtaccttcatgaa
aacggtattatacaccgtgacttaaagccagagaatgttttactgtcatctcaagaagag
gactgtcttataaagattactgattttgggcactccaagattttgggagagacctctctc
atgagaaccttatgtggaacccccacctacttggcgcctgaagttcttgtttctgttggg
actgctgggtataaccgtgctgtggactgctggagtttaggagttattctttttatctgc
cttagtgggtatccacctttctctgagcataggactcaagtgtcactgaaggatcagatc
accagtggaaaatacaacttcattcctgaagtctgggcagaagtctcagagaaagctctg
gaccttgtcaagaagttgttggtagtggatccaaaggcacgttttacgacagaagaagcc
ttaagacacccgtggcttcaggatgaagacatgaagagaaagtttcaagatcttctgtct
gaggaaaatgaatccacagctctaccccaggttctagcccagccttctactagtcgaaag
cggccccgtgaaggggaagccgagggtgccgagaccacaaagcgcccagctgtgtgtgct
gctgtgttgtga

DBGET integrated database retrieval system