KEGG   Homo sapiens (human): 11231Help
Entry
11231             CDS       T01001                                 

Gene name
SEC63, DNAJC23, ERdj2, PRO2507, SEC63L
Definition
(RefSeq) SEC63 homolog, protein translocation regulator
  KO
K09540  
translocation protein SEC63
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Protein processing in endoplasmic reticulum
Disease
H00545  
Polycystic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    11231 (SEC63)
   04141 Protein processing in endoplasmic reticulum
    11231 (SEC63)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   11231 (SEC63)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   11231 (SEC63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 760 aa AA seqDB search
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIVMARNREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
HTLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVL
LPQSKQQKQKQANGVVGNEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE
QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
PVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcagcagttccagtacgatgacagtgggaacaccttcttctacttcctcacc
tccttcgtggggctcatcgtgatcccggcgacatactacctctggccccgagatcagaat
gccgagcaaattcgattaaagaatatcagaaaagtatatggaaggtgtatgtggtatcgt
ttacggttattaaaaccccagccaaatattattcctacagtaaagaaaatagttctgctt
gcaggatgggcattgttcttattccttgcatataaagtttccaaaacagaccgagaatac
caagaatacaatccttatgaagtattaaatttggatcctggagccacagtagcagaaatt
aaaaaacaatatcgtttgctgtcacttaaatatcatccagataaaggaggtgatgaggtt
atgttcatgaggatagcaaaagcttatgctgctttaacggatgaagagtcccggaaaaat
tgggaagaatttggaaatccagatgggcctcaagccacaagctttggaattgccctgcca
gcttggatagttgaccagaaaaactcaattctggttttacttgtatatggattggcattt
atggttatccttccagttgttgtgggctcttggtggtatcgctcaatacgctatagtgga
gaccagattctaatacgcacaacacagatttatacatactttgtttataaaacccgaaat
atggatatgaaacgtcttatcatggttttggctggagcttctgaatttgatcctcagtat
aataaagatgccacaagcagaccaacggataatattctaataccacagctaatcagagaa
attggcagcattaatttaaagaagaatgagcctccacttacctgcccatatagcctgaag
gccagagttcttttactgtctcatcttgctagaatgaaaattcctgagacccttgaagaa
gatcagcaattcatgctaaaaaagtgtcctgccctacttcaagaaatggttaatgtaatc
tgccaactaatagtaatggcccggaaccgtgaagaaagggagtttcgtgctccaactttg
gcatccctagaaaactgcatgaagctttctcagatggccgttcagggacttcagcaattt
aagtctccccttctgcagctccctcatattgaagaggacaatcttagacgggtttctaat
cataagaagtataaaattaaaactatccaggatttggtgagtttaaaagaatcagatcgt
cacactctactgcacttccttgaagatgaaaaatatgaagaggttatggctgtccttggg
agttttccatatgtgaccatggatataaaatcacaggtgttagatgatgaagatagcaac
aacatcacagtaggatccttagttacagtgttggttaagttgacaaggcaaacaatggct
gaagtatttgaaaaggagcagtccatctgtgctgcagaggaacagccagcagaagatggg
cagggtgaaactaacaagaacaggacaaaaggaggatggcaacagaagagtaaaggaccc
aagaaaactgctaaatcaaaaaaaaagaaacctttaaaaaaaaaacctacacctgtgcta
ttaccacagtcaaagcaacagaaacaaaagcaggcaaatggagtcgttgggaatgaagct
gcagtaaaggaagatgaagaagaagtttcagataagggcagtgattctgaagaagaagaa
accaatagagattcccaaagtgagaaagatgatggtagtgacagagactctgatagagag
caagatgaaaaacaaaacaaagatgatgaagcagagtggcaagaattacaacaaagcata
cagcgaaaagagagagctctattggaaaccaaatcaaaaataacacatcctgtgtatagc
ctttactttcctgaggaaaaacaagaatggtggtggctttacattgcagataggaaggag
cagacattaatatccatgccatatcatgtgtgtacgctgaaagatacagaggaggtagag
ctgaagtttcctgcaccaggcaagcctggaaattatcagtatactgtgtttctgagatca
gactcctatatgggtttggatcagattaaaccattgaagttggaagttcatgaggctaag
cctgtgccagaaaatcacccacagtgggatacagcaatagagggggatgaagaccaggag
gacagtgagggctttgaagatagctttgaggaagaagaggaggaagaagaagatgatgac
taa

DBGET integrated database retrieval system